KEGG   Aerococcus christensenii: AWM71_05485Help
Entry
AWM71_05485       CDS       T04262                                 

Definition
(GenBank) UDP-N-acetylmuramyl peptide synthase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
acg  Aerococcus christensenii
Pathway
acg00550  Peptidoglycan biosynthesis
acg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AWM71_05485
Enzymes [BR:acg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     AWM71_05485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M A2L_zn_ribbon DmpG_comm Zn_Tnp_IS1595 PHD Zn_ribbon_17
Motif
Other DBs
NCBI-ProteinID: AMB92761
LinkDB All DBs
Position
1156213..1157568
Genome map
AA seq 451 aa AA seqDB search
MTMRAQVTKGIARTVQKTLKRWTSGGTSFPGKLAKALDPEILKNLAKDYRVVIITGTNGK
TVTTGLTVNILRQRYAHVLTNDTGSNMEQGIISTFLQAESDKKEDKIAVLEVDEASVRHV
TRYIQPEVILTTNLFRDQMDRFGEIYTTFDYILEGADQVPDTLLMMNGDAPIFSSRAYQH
KVSYFGFRNEDKTKDLMAHYNTDGVLCPNCQHILHYHAITYSNLGDYFCPNCSFKRPELS
YEVERVDELTTESASFTIEGHTYTIPVAGVYNIYNALAAYSLAKYFGLSQEEIQEGLGQA
KRIFGRQEKLTLADKDVRINLIKNPVGFNQIVSLLALDSEDFSLVILLNDRSADGEDISW
IWDGLFEDLVHLSQLRAVTIGGLRRLDLFTRVKVAGYPKEAIHVVENYPETLEAIKNMPT
QKVYVLATYTAMLGIRRELSDQGLVKERMKS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgagcacaagtcacgaaaggaatagcaagaactgttcaaaagaccttaaaa
cgatggaccagtgggggaacgagtttccccggtaaattagcaaaggctctcgatccagaa
attttaaagaatttggcgaaagactatcgtgtggtgattattaccgggaccaatgggaaa
actgtgaccacaggactgactgtgaatattttaaggcaacggtacgctcatgttctgacc
aacgatacaggatccaatatggagcagggaattatttccacctttttacaagcagagagt
gacaaaaaagaggataagattgcagttctcgaggtggatgaagccagcgtccgtcacgtc
actcgttatattcaacctgaagtgatcttaacgaccaatttatttagagatcaaatggat
cgttttggggagatctatacgacttttgattatatcttagagggagccgatcaagtcccg
gacacgcttctgatgatgaacggggatgcgcctatcttttcgtcgagagcctaccagcat
aaagtctcctattttggatttaggaatgaagataagacaaaagatcttatggctcactac
aatacggatggggtcctctgtccgaactgtcaacatattctccactatcatgccattacc
tattccaacttgggagactatttctgcccgaattgttccttcaaacgcccagagctgagt
tatgaagtggaacgggtagatgagttaactacagagagtgcctccttcaccatagagggg
catacgtatacgatcccagtagcgggggtttacaatatctacaatgctttagcggcatat
agtctggccaaatattttggcttgagtcaagaggagattcaagaaggtttagggcaagct
aagcgaatctttggccgacaagagaaattaaccttagcggataaggatgttcggattaac
ctcattaaaaatccagtgggtttcaaccagattgtctccttactggccctagattcagaa
gatttttctttagttattttgttgaatgaccgttctgcagacggcgaggatatttcttgg
atttgggacggcttgttcgaagatttggttcacctttcgcaacttcgagcagtgacgatt
gggggcttacgtcgcttagacctctttacccgggtaaaggtagcaggataccccaaagaa
gctattcatgtcgtggaaaattatcctgaaaccctcgaagccattaagaatatgcctacc
caaaaggtctatgtcttagccacttatacagcgatgcttggcattcgtcgggaactatcg
gaccaaggattagtgaaggagcggatgaagtcatga

DBGET integrated database retrieval system