KEGG   Pseudarthrobacter chlorophenolicus: Achl_0742Help
Entry
Achl_0742         CDS       T00834                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00620  Pyruvate metabolism
ach00680  Methane metabolism
ach01100  Metabolic pathways
ach01120  Microbial metabolism in diverse environments
ach01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Achl_0742
  Energy metabolism
   00680 Methane metabolism
    Achl_0742
Enzymes [BR:ach01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Achl_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACL38739
UniProt: B8HC29
LinkDB All DBs
Position
791706..794519
Genome map
AA seq 937 aa AA seqDB search
MAHTAAHPESDLASELRADVRRVSTLLGESLVRQHGPELLDLVEQVRLLTKESKEAARGG
ADATGPWSAHDVVAQVRELLGSLPIEQATDLVRAFAFYFHLANAAEQVHRVRGLRTRAEK
DGWLAKTVAEIAGQAGPEVLQEVVNGLDVRPIFTAHPTEASRRSVLDKIRKLSDVLAQPT
IEGTTARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLGGILTDAMPEMLSEL
SELLSEHGVTLAAQDAPVKFGSWIGGDRDGNPNVTAAVTREILQIQNQNAIRISIGMIDE
LISILSNSTALAGADQVLLDSIDADLKKLPGLDKRVLELNAQEPYRLKLTCIKAKLINTG
KRVAANSNHEHGRDYSSTDELLADLDLLELSLRNHSASLAADGALARVRRAIASFGLHLA
TLDIREHADHHHDAVGQLMDRIGGPGLHYAELSRKERFEVLGSELASRRPLSGHPIKLDG
AADGTYDVFREIRRALRMYGPDVIETYIISMTRGADDVLAAAVIAREAGLVNLFGEKPYA
KLGFAPLLETVEELRASAEIIDQLLSDPSYRELVRLRGDVQEVMLGYSDSNKESGVMTSQ
WEIHKTQRKLRDIAAKHGVRVRLFHGRGGSVGRGGGPTYDAILAQPNGVLEGEIKFTEQG
EVISDKYSLPELARENLELSLAAVLQGSALHRDPRTSDDQRERYAHVMETISDAAFERYR
SLIDHPDLPAYFMASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVP
GWFGVGSGLKAAREAGNSEQLVEMIGQWHFFRSVLSNVEMTLAKTDLDIAGYYVDTLVPK
ELHHIFRAIREEYELTVTEVQNLTGEHVLLDAQPTLKRSLEVRDQYLDPISYLQVELLRR
VRAEAGEGMSNGEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggctcacactgcagcacaccccgaatccgatcttgcctccgaactcagggcagacgtc
cgccgggtctccaccctgctgggcgaatccctggtccgccagcacgggcccgagctcctt
gacctcgtggagcaggtccgcctcctcaccaaggaatccaaggaggctgcccgcggcggt
gccgacgccaccggcccgtggagcgcgcacgacgtcgtcgcccaggtccgcgaactgctg
ggctccctgccgattgagcaggcaacggacctggtgcgcgccttcgcgttctatttccac
ctggccaacgccgccgaacaggtccaccgcgtccgtggcctgcggacccgcgccgagaag
gacggctggctggccaagaccgtagccgagatcgccggccaggccggacccgaggtgctg
caggaagtggtcaacgggctcgacgtccgccccatcttcacggcccaccccaccgaggcc
tcccgccgctcggtgctggacaagatccgcaagctctccgacgtcctggcccagcccacc
atcgagggcaccactgcccgccgccgccaggaccgccagctggccgaaatcatcgaccag
atgtggcagaccgacgaactccgccaggtccggcccaccccggtggacgaagcccggaac
gccatctactacctgggcggcatcctcacggacgccatgccggaaatgctgtccgagctg
tctgaactgctcagtgaacacggcgtcaccctggccgcgcaggacgccccggtgaagttc
ggctcctggatcggcggtgaccgtgacggcaaccccaacgtgacggcagcggtcacccgc
gagatcctccagatccagaaccagaacgccatccgcatcagcatcggcatgatcgacgaa
ctgatctccatcctctccaattccacggcgctcgccggcgcggaccaggtgctgctggac
tccatcgacgcggacctgaagaagctccccggcctggacaagcgggtcctggaactgaac
gcccaggagccctaccggctgaagctgacctgcatcaaggccaagctgatcaacaccggc
aagcgcgtcgcagcgaactcgaaccacgaacacggccgcgactacagcagcacggacgaa
ctcctggcagacctggacctgctggagctgtcgctccgcaaccactcggcgtccctggcc
gcagacggcgccctcgcccgggtccgccgcgccatcgcgtccttcggcctgcacctggcc
accctcgacatccgtgaacacgccgaccaccaccacgacgccgtcgggcagctcatggac
cgcataggcggccccgggctgcactacgccgaactgagccgcaaggagcgcttcgaggta
ctgggttccgagctcgcctcccgccgcccgctgtccggccacccgatcaagctcgacggc
gccgctgacggcacgtacgacgtcttccgcgaaatccgccgggccctgcgcatgtacggc
ccggatgtcatcgagacctacatcatctccatgacccgcggggcggacgacgtcctggcc
gcggccgtgatcgcccgcgaagccggcctggtcaacctgtttggtgagaagccctacgcc
aagctggggttcgcgccgctgctggaaaccgtggaggaactccgtgcctccgccgagatc
atcgaccagctcctctccgacccctcctaccgcgaactggtgcggctgcgcggggacgtc
caggaagtcatgctgggctactcggactccaacaaggaatccggcgtgatgaccagccag
tgggaaatccacaagacccagcgcaagcttcgtgacatcgccgcaaagcacggcgtccgc
gtccgcctgttccacggccgcggcggttcggtgggccgcggcggcgggcccacctacgac
gccatcctggcccagcccaacggcgtcctggaaggcgaaatcaaattcaccgagcagggc
gaggtcatctcggacaagtactcgctgcctgagcttgcccgcgaaaacctggagctttcg
ctggctgccgtgcttcagggttccgcgctgcaccgcgatccccggacctccgacgaccag
cgtgaacgctacgcgcacgtcatggaaaccatctccgatgccgccttcgagcggtaccgc
agcctgatcgaccacccggacctgccggcgtacttcatggcctccaccccggtggagcag
ctcgggtcgctgaacatcggctcccgcccgtccaagcgccccgactcgggtgcgggcctt
ggcgggctgcgcgccatcccgtgggtgttcggctggacacagtcccggcagatcgtcccc
ggctggttcggtgtcgggtcggggctcaaggccgcccgcgaggccggcaactcggagcag
ctggtggagatgatcgggcagtggcacttcttccgctccgtgctctccaacgtggagatg
accctggccaagacggacctggacatcgccggctactacgtggacaccctggtccccaag
gagctgcaccacatcttccgtgccatccgtgaagaatacgaactcacggtgaccgaggtg
cagaaccttaccggcgagcatgtgctcctggacgcccagcccacgctcaagcgctccctc
gaggtccgcgaccagtacctggaccccatcagctacctccaggtggaactgcttcgccgc
gtccgcgcagaggccggcgagggcatgagcaacggcgagatcgacgaacgcctccagcgg
gccatgctcatcaccgtcaacggtgtggcagccggcctccgcaacaccggctaa

DBGET integrated database retrieval system