KEGG   Pseudarthrobacter chlorophenolicus: Achl_2036Help
Entry
Achl_2036         CDS       T00834                                 

Definition
(GenBank) domain of unknown function DUF1727
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00550  Peptidoglycan biosynthesis
ach01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Achl_2036
Enzymes [BR:ach01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     Achl_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M Thymidylate_kin Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACL40010
UniProt: B8H9E1
LinkDB All DBs
Position
2296034..2297326
Genome map
AA seq 430 aa AA seqDB search
MPFYTVPLGKLVRRVSRLRGGGSALPGLVVEKIDPGFMRRTLTTLPHGVAVVSGTNGKTT
TTKMVVELLESQGLKVFTNRTGSNFTRGVAAALLGEVDWRGRLDADVAVLELDEAHAVHF
VNSVPPKYCLLLNVLRDQLDRFGEIDKTAQLLQHIAAKTTGTVVLNREDPRVARIAETLT
GQEVRYFGLDDSLLGTFPNDDDMRAAPGSPAPAGLPEKPAADVVLRKVGADSAEFEYDGG
TVSTAMKLRGVYNIFNAAAALTLARSICGGAAADTNHETLLEALSQVAPAFGRGESLTVE
GQPLDLVLVKNPSGFRLGLKSFPAGGYATMIAINDNYADGRDMSWLWDVEFDSLRAGGVD
QLTGSRAYDMALRLQYDDVRIGAVEPDIAPALAAFIRGAKGQPKRIFCTYTAMLAIRREL
SKITTVEVVS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcccttttacactgttccgcttggcaaactggtgcgccgggtatcccggcttcgaggc
ggcgggtccgcgctgccggggctcgtcgtcgaaaagatcgaccccggtttcatgcggcgg
acactcactacccttccgcatggtgtggccgtggtcagcggcacgaacgggaagaccacc
accaccaagatggtggtggagctgctcgaaagccagggcctgaaggtttttacgaaccgc
accggaagcaatttcacccgcggcgttgccgctgccctgctgggcgaggtcgactggcgt
gggcggctggacgccgacgtcgccgtcctcgaactggacgaggcccacgccgtgcacttc
gtgaacagcgtgccgccgaagtactgcctgctgctgaacgtcctgcgcgaccagctggac
cggttcggtgagatcgacaagacagcccagctcctgcagcacatcgccgcgaaaaccacc
gggaccgtggtgctgaaccgcgaagacccgagggtggccaggatcgcggaaaccctcacg
ggccaggaggtccggtacttcggcctggacgactcgctgctgggcaccttccccaacgac
gacgatatgcgcgccgctccgggcagccccgcgccggcgggcctcccggagaagcccgcg
gccgacgtcgtgctccgcaaagtgggcgccgacagtgccgagtttgagtacgacggcggg
accgtcagtaccgcgatgaagctccgcggggtctacaacatcttcaacgcggccgctgcg
ctgaccttggcgcgcagcatttgcggcggagccgcggcggacaccaaccacgaaaccctg
ctggaggccctgtcccaggtggcacccgccttcggccgcggcgaaagcctcacggtggaa
ggccagcccctggacctggtgctggtgaagaaccccagcggtttccgccttggactcaag
tcctttccggcgggcggttacgccaccatgatcgccatcaatgacaactacgccgacggc
cgggacatgtcctggctgtgggacgtggaattcgattcgctccgggccggaggcgtggac
cagctgaccggttcccgcgcctacgacatggccctgcggctccagtatgacgacgtccgc
atcggtgccgtggaacccgacatcgcaccggccctcgccgcgttcatccggggtgcgaag
ggtcagcccaagcgcatcttctgtacctatacggccatgctcgccatccggcgcgaactg
tcgaagatcaccaccgtggaggttgtctcttga

DBGET integrated database retrieval system