KEGG   Pseudarthrobacter chlorophenolicus: Achl_3146Help
Entry
Achl_3146         CDS       T00834                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00330  Arginine and proline metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01130  Biosynthesis of antibiotics
ach01230  Biosynthesis of amino acids
Module
ach_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ach00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Achl_3146
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Achl_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA 3HCDH_RFF Shikimate_DH 3HCDH_N Sacchrp_dh_NADP PDH
Motif
Other DBs
NCBI-ProteinID: ACL41107
UniProt: B8HFR4
LinkDB All DBs
Position
complement(3499121..3499954)
Genome map
AA seq 277 aa AA seqDB search
MSNRIAFLGCGSMNEAILGGLVEAGTNPADIVATVRRAERAAELAERYHGITAIAGEEEP
DNNRQAAKGSAVVILGVKPVGIADLAREISPALTPDTIVVSVAAAVSIAQLEAALPAGQP
VIRTMPNTPAKLGRGVISVSPGTNCTPGQLQQVKDLFQGAGTVVEVPEEQVDALSAISGS
GPAYAFYLAEAMASAGEELGLDRELAVLLARETVAGAGFMLAEPGADPSALRKSVTSPNG
TTERAIATFDEQGIPSIIAAGARAAADRAAEITKQLG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgaatcgcattccttggctgtgggtccatgaacgaagccatcctcggcggc
ctggtggaagccggcaccaacccggcggacatcgtggcgacagtccgccgggccgagcgc
gccgctgaactggccgagcggtatcacggcatcaccgcgatcgccggcgaggaggaaccg
gacaataaccggcaggccgcgaaggggtccgccgtcgtgatccttggcgtcaagccggtg
ggcatcgcggacctggcccgggagatcagccccgcgctcaccccggacacgatcgtggtc
agcgttgccgccgccgtttccatcgcccagcttgaagccgccctcccggcggggcagccg
gtcatccggaccatgcccaacaccccggcgaaactgggccgcggcgtcatctccgtctcg
cccggcaccaactgcacacccggccagctccagcaggtgaaggacctcttccagggtgcg
ggaaccgtcgtcgaagtgcccgaggagcaggtggacgcgctctcggccatcagcggctcc
ggacccgcctacgcgttttacctggccgaggccatggcctcggcgggggaggaactgggc
ctggaccgcgaacttgccgtgctgctggcccgggagaccgtggcaggcgccggcttcatg
ctggcagagcccggcgcggatccgtcggcactgcgtaagtcagtgaccagccccaacggc
accaccgaacgcgccattgccactttcgatgagcagggcattccgtccatcatcgccgcc
ggcgcgcgggcagcagcggaccgggcagcggaaatcaccaagcagctcggctaa

DBGET integrated database retrieval system