KEGG   Pseudarthrobacter chlorophenolicus: Achl_3859Help
Entry
Achl_3859         CDS       T00834                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ach  Pseudarthrobacter chlorophenolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACL41812
UniProt: B8H809
LinkDB All DBs
Position
complement(4303519..4304592)
Genome map
AA seq 357 aa AA seqDB search
MPPVPPMLAKSVSGIDGIPKGSDLSYEPKWDGFRSIIFRDGDDLEIGSRNEKPMTRYFPE
LVVALKDNLPERCVVDGEIILIGASGDRLDFDTLQQRIHPAASRVKLLSEQTPASFVAFD
LLALGDDDYTGRPFAERRAALEKALAASEAPVHLTAATTDKDTAGQWFEQFEGAGLDGLV
AKRLDGPYEPDKRTMFKIKHERTADCVVAGYRLHKSGPDVIGSLLLGLYKDDGGLASVGV
IGAFPMKRRQELFQELQPLVTDFDNHPWAWAKQEEGERTPRNAEGSRWSAGKDLSFVPLR
PELVVEVRYDHMEGERFRHTAQFNRWRPDRDPESCTYAQLEEPVNFDLASVLETGRA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtcccgcccatgctcgccaaatccgtcagcggcatcgacggcatccccaaa
ggcagcgacctcagctacgaaccgaaatgggacggcttccggtccatcattttccgcgac
ggcgatgatctggagatcggcagccgcaacgagaaaccgatgacccgctacttccctgaa
ctggtggtcgcgctgaaggacaacctcccggagcgctgcgtggtggacggcgagatcatc
ctgatcggtgcctccggggaccggctcgatttcgacaccctccagcagcgcatccacccc
gccgccagccgcgtcaaactcctgtccgagcagaccccggcctcgttcgtggccttcgac
ctgctggccctgggcgatgacgactacaccggcaggcccttcgccgaacgccgggcggcg
ctggaaaaggcgcttgccgccagcgaggccccggtacacctcaccgccgccaccacggac
aaggacacggcaggccagtggttcgagcagttcgagggcgcagggctggacggcctggtg
gccaagcgcctggacggcccgtacgaaccggacaaacggaccatgttcaagatcaagcac
gagcggaccgccgactgcgtggtggccggctaccgcctgcacaagagcgggccggacgtc
atcgggtcgctgctcctgggcctctacaaggacgacggcggcctggccagcgtgggcgtc
attggcgccttcccgatgaagcgccggcaggagcttttccaggaactgcagccgctggtg
accgatttcgacaaccacccctgggcctgggcaaagcaggaggaaggggaacggacgccc
cgcaacgccgagggcagccgctggagcgccggcaaagacctgtctttcgtgccgctccgg
cctgagctggtggtggaagtccgctacgaccacatggagggggagcggttccgccacacc
gcccagttcaacaggtggcggccggaccgggacccggagtcgtgcacgtacgcccagctg
gaggaaccggtgaacttcgacctcgcatcggtgctggagaccgggagggcgtaa

DBGET integrated database retrieval system