KEGG   Pseudarthrobacter chlorophenolicus: Achl_4500Help
Entry
Achl_4500         CDS       T00834                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ach  Pseudarthrobacter chlorophenolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: ACL42451
UniProt: B8HJ53
LinkDB All DBs
Position
pACHL02:6008..7042
Genome map
AA seq 344 aa AA seqDB search
MGISAGLPAGLAPPVKVALARAVDKMPRGDVARGALLFEPKWDGYRCVAVRDDRGATLWS
RQGKELSGYFPELCAAIVSAVPPGCVIDGEAVIWSQGRLNFDALQQRLGAGPKILPGLVT
AAPANYVAFDVLAVAGHDARNLPLSDRRALLEELATGWEPPLSLSPTTTDRSVAEQWLEE
LPHTGIEGLVIKGTNQPYTPGVRSWLKLKHRETLDIICGAVIGPITQPSEVVAGLILDGE
LRIVGRSTPLKMRESRELARWLQPPMGAHPWPAIVKGRALDRFNRDKEPVALTLVEPVVI
EVSADTSWSGKSFRHPLRILRARPELSPADVISPKQLRSAVEGP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcagcgccgggttgccggcagggcttgcccctccggtgaaagttgcgctggcc
cgcgccgtggacaagatgcctcgcggtgacgtagcacgaggcgcactgctgtttgaaccc
aagtgggatgggtacaggtgtgttgcagtcagggatgaccgtggggccacgctgtggtcc
cggcaagggaaggaactgtctgggtacttccctgaactctgcgccgcgatcgtttcggcc
gttccaccgggatgtgtgatcgacggcgaagccgtgatctggagccagggaaggctgaac
ttcgacgccctgcagcagcgcctgggcgcaggaccaaaaatcctgccggggctggtcacg
gcagcgcccgccaactatgtagctttcgacgtcttggccgtggccgggcatgacgcaagg
aacctgcctctgagcgaccgccgggcgctcctggaagaactagccacgggctgggaaccg
ccgctgtccctctcccccaccaccacggaccgcagcgttgccgagcagtggctcgaagag
ctgccgcataccgggatcgaagggttggtcattaaggggaccaaccagccgtacacgccg
ggtgtccgttcctggttgaagctcaagcacagggaaaccctggacattatctgcggcgca
gtgatcgggccgattacccaaccctccgaggtcgtcgccggcctgatcctggacggcgag
ctgcgaatcgtcggacgctccacaccactgaagatgagggaaagccgggaactggcacgg
tggctgcagcccccaatgggtgcgcacccctggccggccattgtgaaaggaagggccctg
gataggttcaaccgagacaaggaacccgtggcgctgacgcttgtagagcccgttgttatt
gaggtctccgccgacacctcatggtccgggaagtccttccggcaccccttgcggatacta
agggcgaggcccgagctatcccctgccgacgtcatttcgccaaaacagctgcgttctgcc
gttgagggcccgtga

DBGET integrated database retrieval system