KEGG   Achromobacter sp. B7: DVB37_06785Help
Entry
DVB37_06785       CDS       T05703                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
achb  Achromobacter sp. B7
Pathway
achb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
achb01100  Metabolic pathways
achb01110  Biosynthesis of secondary metabolites
achb01130  Biosynthesis of antibiotics
achb01230  Biosynthesis of amino acids
Module
achb_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
achb_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DVB37_06785
Enzymes [BR:achb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     DVB37_06785
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     DVB37_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HrpE
Motif
Other DBs
NCBI-ProteinID: AYD63660
LinkDB All DBs
Position
1518926..1520011
Genome map
AA seq 361 aa AA seqDB search
MDEDLQRKLRPLRERIDALDAQILDLLSQRARAALEVGEAKHAAQADGPVLRPEREAEVI
RRLQQINPGPFPNAGVASVWTEIISACRGLERGMTVAYLGPQGSFSEQAALEHFGHAVQK
LPCASFDEVFRAVEGGQADVGMVPVENSTEGAVNRSLDLLLNTPLTILGERSLVIRHCLM
SQSGTMDGIKTISAHPQALAQCQGWLTRNYPDVERVAASSNSEAARASAGDPTIAAIAGE
VAAPAWNLQVIAAGIQDDPHNRTRFLAIGNIQPLVSGKDKTSLILAVPNRAGAVYEMLAP
LADNGVSMTRFESRPARTGQWEYYFYVDVLGHRNDPNVQRALATLQAQVAYLKVLGSYPA
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagacctgcaacgcaagttgcgccccttgcgcgaacgcatcgatgcgctggac
gcgcagatcctcgacctgctgtcgcagcgcgcccgcgccgcactggaagtcggcgaagcc
aagcacgccgcacaagccgatggcccggtgctgcgccccgagcgggaggccgaagtcatc
cgccgcttgcagcagatcaaccccggcccgtttccgaatgcgggcgtggcgtcggtctgg
accgaaatcatctcggcctgccgaggcctggaacgcggcatgacagttgcctacctgggc
ccgcaaggttcgttttccgagcaggcggcgctggagcattttggccacgccgttcagaag
ctgccttgcgcgtcgtttgacgaggtgtttcgcgccgtcgagggcgggcaggccgatgtg
ggcatggtgccggtggaaaactccaccgagggcgccgtcaaccgcagcctggatctgctg
ctgaatacgccgctgacgatcctgggcgagcgctcgctggtgatccgccattgcctgatg
tcgcagtcgggcaccatggacggcatcaagaccatttccgcgcacccgcaagcgctggcg
cagtgccagggttggctgacacgcaactatcccgatgtggaacgggttgccgcgtccagc
aactccgaagcggcgcgcgcctcggcgggcgacccgaccatcgcggcgattgccggtgaa
gtggccgcgcccgcctggaatcttcaagtcatcgcggccggcattcaggacgatccgcac
aaccgcacccggttcttggccatcggcaatatccagccgctggtcagcggcaaggacaag
accagcctgatcctggccgtgcccaaccgcgccggcgccgtctacgaaatgctggcgccc
ctggcggacaacggcgtgtcgatgacccgcttcgagtcgcgccccgcgcgcaccggccag
tgggaatattatttttacgtagacgtcctgggtcatcgtaatgatccgaacgttcagcgc
gcgcttgccacgttgcaggcgcaggttgcctacctgaaggtgctgggttcgtacccggcg
ccgtga

DBGET integrated database retrieval system