Achromobacter sp. B7: DVB37_09365 Help Entry DVB37_09365       CDS       T05703                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism achb  Achromobacter sp. B7 Pathway achb00998   Biosynthesis of various antibiotics achb01100   Metabolic pathways achb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:achb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DVB37_09365   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DVB37_09365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYD64104 LinkDB All DBs Position complement(2075532..2075792) Genome browser AA seq 86 aa AA seqDB search MNQLELELKTLVIESLGLEDITPDDIASDAPLFGEGLGLDSVDALELGLALQKRYSIAID PETRNMREHFTSISSLADFVAAQRRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaccaattggaacttgagctcaagacgctcgtcatcgaatcgctgggtctggaagac atcacccccgacgacatcgcgtccgacgccccgctgtttggcgagggattggggctggat tcggtcgatgcccttgagctgggcctggcgctgcaaaagcgctacagcatcgccatcgat cccgaaacgcgcaacatgcgcgagcatttcaccagcatcagcagcctggcggactttgtc gccgcgcagcgccgcgcttaa

DBGET integrated database retrieval system