KEGG   Achromobacter sp. B7: DVB37_12290Help
Entry
DVB37_12290       CDS       T05703                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
achb  Achromobacter sp. B7
Pathway
achb00564  Glycerophospholipid metabolism
achb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DVB37_12290
Enzymes [BR:achb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DVB37_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Thi4 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AYD64609
LinkDB All DBs
Position
complement(2719680..2721275)
Genome map
AA seq 531 aa AA seqDB search
MNQPLANVTPPDRNRLLSTLDNTPSWDVIVIGGGATGLGTAVDAASRGYRTLLIEGADFA
KGTSSKATKLVHGGVRYLAQGNVSLVREALHERGLLNRNAPHLVWPLGFVVPAYNLFDQP
FYGIGLKMYDMLAGKLNLAPSRWLSRRDTLANAPTLAEKVNGRGLKGGVLYYDGQFDDAR
LAMSLMRTLFDLGGTAVNYVRATGLTTSHGKVDGVTAQDVIGGASFSLRARCVINATGVW
VDAVRRMEDKNAATMVAPSQGVHLTLPREFLPGNRAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRGDLPLDPQAGAQDVDFILNTAARYLSRKPTRDDVTSVWAGLRPLVKATGEAATK
QLSREHTILVSNAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQASCRTESLPLHGASG
LAPSQEHAGTPDSYYGSDLATLKALPGAERMLVKASGLSEAHVRFAARFELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGHDAAWQQRTLQELAVVAATYRL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacccctagccaacgtcactccgcccgatcgcaaccgcctgctgtccaccttg
gacaacacgccgtcctgggacgtcatcgtcatcggcggcggcgccacgggcctgggcacc
gccgtggacgcggcatcgcgcggttaccgcacgttgctgatcgaaggcgcggactttgcc
aagggcacgtccagcaaggcaaccaagctggtgcacggcggcgtgcgctacctggcgcag
ggcaacgtcagcctggtgcgagaagcgctgcacgaacgcggccttttgaaccgcaacgcg
ccgcatctggtgtggccgctgggctttgtggtgcccgcctacaacctattcgaccagccc
ttctacggcatcggcctgaagatgtacgacatgctggcgggcaagctgaacctggcgccc
agccgctggttgtcgcgccgtgacaccctggcgaacgcgccgacgctggctgaaaaggtc
aacgggcgcgggctgaagggcggcgtgctgtattacgacggccagttcgatgacgcgcgc
ctggcgatgagcctgatgcgcacgctgttcgacctgggcggcacggcggtcaactacgtg
cgcgccaccggcctgaccacctcccacggcaaggtcgacggcgtgaccgcgcaggacgtg
atcggcggcgccagcttttcgctgcgcgcgcgctgcgtgatcaacgccaccggcgtgtgg
gtggatgcggtgcgccgcatggaagacaagaacgcggccacgatggtggcgcccagccag
ggcgtgcacctgaccttgccgcgcgaattcctgccgggcaatcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccatggaacggccacaccatcgtgggc
accaccgacacgccgcgtggcgacctgccgctggacccgcaagccggtgcgcaggacgtg
gacttcatcctgaacacggcggcgcgctacctcagccgcaaacccacgcgcgatgacgtc
accagcgtgtgggcgggcttgcgtccgctggtcaaggccaccggcgaggccgccaccaag
cagctgtcgcgcgagcacaccatcctggtgtccaacgccggcttggtgacggtgacgggc
ggcaagtggaccacctaccgccgcatggcgcaggacgtggtggacaccgcgatccagcat
cagttgctgacgcaggcgtcgtgccgcaccgagtccttgccgttgcatggcgcgtccggg
ctggcgccgtcgcaggaacacgcgggcacgccggacagctattacggcagcgatctggcc
acgttgaaggccctgccgggtgccgagcgcatgctggtcaaggccagcgggctgtccgag
gcgcatgtgcgctttgcggcgcgttttgaattggcgcgcagcgccgaagacgtgctggcg
cgtcgcaaccgcgcgctgttcctggacgcggaagccgcgatgctggccgcccccgaagtg
gcccgcatcctggccgaagaactgggccacgacgcggcctggcaacaacgcacgttgcag
gaactggcggtcgttgccgcgacgtatcggctgtag

DBGET integrated database retrieval system