KEGG   Achromobacter sp. B7: DVB37_16180Help
Entry
DVB37_16180       CDS       T05703                                 

Definition
(GenBank) MFS transporter
Organism
achb  Achromobacter sp. B7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AYD65283
LinkDB All DBs
Position
complement(3609396..3610853)
Genome map
AA seq 485 aa AA seqDB search
MQSSTVKIRGIDDVIAFIDSRPGITGRAGLIWWLALGGLFLDAFANSALSAGLGPMTRDL
GLAAGQVALMTSFAAWVAIAFNPIGGWMADRWGRIRPLVIAKFLAVIGALLVMFAPSFEV
ILVGRFFVGAAYGIDFAIAMAVLAEFTPLKFKSRLNTWQGMWYTAVCTNLLLALLFFSWD
VGDSIWRYSVAATAVFAVVILLLQMRYMVESPIWLARKERVEQAARAMTRIYGQPFAAAP
MHERVPVVNQARRGIANVLLIFRGVYLPRTILAATVQIGQSIQYFAVGWYLPLISAALFG
KDFVFATIGALVFNVFGIFGGFLSPYIGRKLGLRRASAFGFAAVFLMLLILGTFHGKMPL
WLAVVVPSLFILFHSGGPGANGKSLSSLSFRSELRAGANGIIGALGSTGAAIGLLVFPLF
RENYGLEKTFLILSIVPLIASIICFTIKWDPTRTPINPDNEADAPQFKDDAVLPALDPAI
GKASR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatcatcgaccgtaaaaatacgtggcatcgacgatgtcatcgcttttatcgactca
cgccccggtatcaccgggcgggctggcctgatctggtggctggccctgggtggactattc
ctggatgcgtttgccaactccgcgttaagcgcggggctggggcccatgacgcgcgacctg
ggccttgcggccggtcaagtcgcgctgatgacctcgtttgccgcgtgggtggccattgcg
ttcaatcccatcggcggttggatggcggatcgttggggccggatccggcccttggtcatc
gcaaaattcctggccgtcatcggcgcgctgctggtgatgtttgcacccagctttgaagtc
attctggtcggccggtttttcgtaggcgccgcctacgggatcgacttcgccatcgcgatg
gccgtcctggccgaattcaccccgcttaaattcaaaagccgccttaatacctggcagggc
atgtggtacacggccgtgtgcacgaacctgctgctggcgctgttgtttttctcatgggat
gtgggcgattccatctggcgttattcggttgcggctaccgccgtcttcgcggtcgtgatc
ctgctgctgcaaatgcgctacatggtggaaagcccgatctggctggcccgcaaagagcgt
gtcgagcaggcggcgcgcgccatgacgcgcatctacgggcagccgttcgcggcggcgccg
atgcacgagcgtgtgccggtggtcaaccaggccaggcgcggcattgccaacgtgctgttg
atctttcgtggcgtttacctgccgcgcaccatcctggcggcaacggtccagatcggccag
tcgatccagtatttcgccgtgggctggtatctgcccttgatcagcgccgcgctgttcggc
aaggacttcgtcttcgccaccatcggcgcgctggtgttcaacgtgttcggcatttttggc
ggctttctgtcgccgtacatcggccgcaagctgggcctgcgccgggcgtcggcattcggc
tttgccgcggtgtttctgatgctgctgatcctcggtaccttccacggcaagatgccgctg
tggctggccgttgtggtgccgtcgctgttcatcctgttccattcgggcgggccgggggcc
aacggcaagagcctgtcgtcgctgtcgttccgcagcgaacttcgcgcgggcgccaacggc
atcatcggcgcgctgggctccacgggggccgcgatcggactgctggtgtttccgctgttt
cgcgaaaactacggccttgaaaagaccttcctgattctctccatcgtgccgctgatcgcc
agcatcatctgcttcacgatcaagtgggaccccacccgcacccccatcaacccggacaac
gaagccgacgcgccccagttcaaggacgacgccgtgctgcctgccctggaccccgccatt
gggaaagcctcgcgatga

DBGET integrated database retrieval system