KEGG   Achromobacter sp. B7: DVB37_21575Help
Entry
DVB37_21575       CDS       T05703                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
achb  Achromobacter sp. B7
Pathway
achb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DVB37_21575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:achb02000]
    DVB37_21575
Enzymes [BR:achb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DVB37_21575
Transporters [BR:achb02000]
 Other Transporters
  Pores ion channels [TC:1]
   DVB37_21575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AYD66227
LinkDB All DBs
Position
complement(4760291..4760905)
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRVLWLLEELGVPYDTEMVSIRGTDSAGHMPADYIDIHPHRKVPAVVH
DGVPIFETPAIALYLTDLFPEKGLGPRIGDPNRGPYLTWLAYSTGVFEPAMVERAFKQPH
HAGAPGWGSADEVEQVLTRVLQARPFFLGDAFSAVDIVLGGSLQYMMQVNVIAESDVFNG
YIERLAARPAMHRALQRDGDIEES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgctctaccatgcgccgcgttcgcgctcgttccgggttctgtggctgcttgaa
gaactgggtgtgccgtacgacaccgaaatggtgtccatccggggcaccgacagcgccggg
cacatgcccgccgactacatcgacattcatccgcaccgcaaggtgccggccgtggtgcac
gacggtgtgcccatctttgaaacccctgccatcgcgctgtacctgacggacctgttcccc
gagaaaggcttgggtccgcgcatcggcgaccccaatcgtggcccgtatctgacctggttg
gcgtattccaccggggtgttcgagccggccatggtcgaacgcgccttcaagcagccgcat
catgccggcgccccggggtgggggtcggccgacgaagtcgaacaggtcctgacccgcgtg
ctgcaagcccggcccttttttctgggcgacgcgttttcagcggtggacatcgtgctgggc
ggttcgctgcaatacatgatgcaggtgaacgtgattgccgaatcggacgtgttcaacggc
tacatcgaacgcctggccgcgcgcccggccatgcaccgggctctgcaacgcgacggcgac
atcgaagagtcctga

DBGET integrated database retrieval system