KEGG   Achromobacter sp. B7: DVB37_21615Help
Entry
DVB37_21615       CDS       T05703                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
achb  Achromobacter sp. B7
Pathway
achb00061  Fatty acid biosynthesis
achb00780  Biotin metabolism
achb01100  Metabolic pathways
achb01130  Biosynthesis of antibiotics
achb01212  Fatty acid metabolism
Module
achb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DVB37_21615 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DVB37_21615 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DVB37_21615 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:achb01004]
    DVB37_21615 (fabI)
Enzymes [BR:achb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DVB37_21615 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DVB37_21615 (fabI)
Lipid biosynthesis proteins [BR:achb01004]
 Fatty acid synthase
  Component type
   DVB37_21615 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AYD67795
LinkDB All DBs
Position
4768685..4769479
Genome map
AA seq 264 aa AA seqDB search
MNSPAPSSSAALPLAGKRGLVTGIANADSIAWGCAKAFRAMGAELAVTYLNDKALPHVEP
LARQVDAPLLMPLNLLNDGELEAVFDRITAEWGQLDFVLHSIAFAPRADLHGRVTDCSRE
GFLQAMDVSCWSFIRMAKLAEPLMKKGGALFCMSYYGSQMVVEHYNMMGPVKAALESATR
YLAAELGPQGIRVHAISPGPLKTRAASGIAEFDALLDRAQSKAPARSLVSIDDVGEATAW
LATDAARLMTGQTLYIDGGYHIID
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaactcccccgccccctcctctagcgcggcgctgccgctggccggcaagcgcggcctg
gtcaccggcatcgccaacgccgattccattgcctggggctgcgccaaggcatttcgcgcc
atgggcgccgaactggccgtgacctatctgaatgacaaggcgctgccccacgtcgagccc
cttgcgcgccaggtggatgcgcccttgctgatgccgcttaacctgctgaacgacggcgaa
ctcgaagccgtgttcgaccgcatcacggccgaatggggacagctggatttcgtgctgcat
tccattgcgttcgccccgcgcgccgacctgcacggccgcgttaccgactgctcgcgcgaa
ggcttcctgcaagccatggacgtgtcgtgctggtctttcatccgcatggcgaaactggcc
gaaccgttgatgaaaaaaggcggcgcgctgttctgcatgagctactacggctcgcagatg
gtcgtcgagcactacaacatgatgggtccggtcaaggccgcgctggaatccgccacgcgc
tacctcgccgccgagcttgggccgcagggcatccgggtgcacgcgatatcacccgggcca
ttgaaaacgcgcgccgcatcgggcattgccgaattcgatgccctgctggaccgcgcccaa
tccaaggcgcccgcgcgcagcctggtgtccatcgacgacgtgggcgaagccaccgcctgg
ctggccaccgacgccgcgcgcctgatgacgggccagacgctgtatatcgacggcggctat
cacatcatcgattag

DBGET integrated database retrieval system