KEGG   Achromobacter sp. B7: DVB37_25580Help
Entry
DVB37_25580       CDS       T05703                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
achb  Achromobacter sp. B7
Pathway
achb00620  Pyruvate metabolism
achb00680  Methane metabolism
achb01100  Metabolic pathways
achb01120  Microbial metabolism in diverse environments
achb01200  Carbon metabolism
Module
achb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DVB37_25580
  09102 Energy metabolism
   00680 Methane metabolism
    DVB37_25580
Enzymes [BR:achb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DVB37_25580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AYD66910
UniProt: A0A386J6U9
LinkDB All DBs
Position
5667962..5670811
Genome map
AA seq 949 aa AA seqDB search
MKASRPQSESAEPLRHDIRLLGRFLGAVIAECEGKRVFDTIETLRRTAVKFRREGNEADS
KLLEQRVKRLQGNDPNSVARAFSYFLHLANIAEDRDQNRRQRTRALAGDTAPRGSLRDAV
QTLGRQGVGVARIRRLLADASVVPVLTAHPTEVQRKSTLDVHREIALALTQRDGVLTPDE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRLYADLSKLLNR
EPTKPFAAPPAPLEPFLRMGSWIGGDRDGNPNVDAATLERALLRQATVLFEHYLQEVHAL
GAELSITTLLISADPELLALADNSGDDSPHRSDEPYRRALVGVYARLAATAQALTGQDLA
RRSTVAAPAYQAPRELSADLAVIAASLAAHHASPIAKLRLSGLQQAVEVFGFHLATVDLR
QSSDVHERALAELFERAGTLHEGKPLDYLALDEDARVALLRAELAQARPLASPWIAYSED
TTRELAVLRAAAAGRARYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPVGQDLDPD
DGLMVVPLFETIPDLQRGADIMAAWLDLPEVRQRVKQAQNGAQEVMLGYSDSNKDGGFLT
SNWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTE
QGEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSDTAQ
RTYRGLVYDTPRFAEYFFAATPISEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCR
LMLTGWYGMGSAIEAYLEVGAEGGPRSRRARLAQLREMARDWPAFRTLLSNMEMVLAKSD
LAIAARYAQLVPQRGLRERVFGLISAEHGRTLAMLKLLTQRELLADNPTLQDSLRERFAY
IDPLNYLQIDLIRRHRAAQNNPKAEIDERVQRAIHLTINGIAAGLRNSG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccagccgcccgcagtccgagtccgcagaacccttgcgccacgatatccgcctg
ctaggccgctttttgggcgccgtgatcgcggaatgcgaaggcaaacgggtgttcgacacc
attgaaacgttgcgccgcaccgccgtgaaattccggcgcgaaggcaacgaggcggacagc
aagctgctggaacagcgcgtcaagcgcttgcaaggcaatgacccgaattccgtggcgcgc
gccttcagctattttctgcatctggccaacattgccgaagaccgcgaccagaaccgccgc
cagcgcacccgcgccttggccggcgacaccgcgccgcgtggcagcctgcgtgatgccgtg
cagacattgggcaggcaaggcgtgggcgtggcgcgcatccgccggctgctggccgacgcc
agcgtggtgccggtgctgaccgcgcatccgaccgaagtgcagcgcaagagtacgctggat
gtgcaccgcgaaattgccctggcgctgacccagcgcgacggcgtgctgacgcccgacgag
ctggccgagctggatgccgcgctgcttggccgcgtggccaccttgtggcagacgcgcatg
ctgcgctacacgcgcctgacggtggccgacgagatcgaaaacgccctgtcgtactaccgc
agcaccttcctgcaagtcatcccgcgcctgtacgcagacctgtccaagctgttgaaccgc
gaaccgaccaagccgtttgccgcgccgcccgcgccgctggaaccgtttctgcgcatgggc
agctggatcggcggcgatcgcgatggcaaccccaatgtggacgccgccacgctggaacgc
gcgctgctgcgccaggccacggtgctgtttgaacactatctgcaagaggtccacgcgctg
ggcgcggaactgtcgatcaccaccctgctgatctccgccgacccggaactgctggcgctg
gccgacaacagcggcgacgattccccccaccgcagcgacgagccctatcgccgcgcgctg
gtcggcgtctatgcccgactggccgccacggcgcaagcgctgacggggcaggacctggcg
cgccgcagcaccgtggcggcgcccgcgtatcaagcaccgcgggaactgtccgccgacctg
gccgtgattgccgcgtcgctggccgcgcaccacgcctcgcccatcgccaagctgcgcctg
tcgggcctgcaacaagcggtggaggtgttcggctttcacctggccacggtcgacctgcgc
caaagctccgacgtgcacgaacgcgcgctggccgaactgttcgagcgcgccggcacgctg
catgaaggcaagccgctggactacctggcgctggacgaagacgcccgcgtggcgctgctg
cgtgccgaactggcacaggcgcgcccgctggcttcgccgtggatcgcctacagcgaagac
accacgcgcgaactggccgtgctgcgcgccgccgccgccggtcgcgcgcgttacggcaag
caggccgtgcgccagaccatcgtgtcgcacaccgaaacgctgagcgacctgctggaagtc
atggtgctgcaaaaggaagcgggcttgatcgccccggtcgggcaggacctggaccccgac
gacggcctgatggtcgtgcccttgttcgaaacgattcccgacttgcagcgcggcgccgac
atcatggctgcctggctggacctgcccgaagtgcgccagcgcgtgaagcaggcgcagaac
ggcgcgcaggaagtcatgctgggctattccgacagcaacaaggacggcggcttcctgacg
tcgaactggtcgctgtaccaggctgaacgcgcactggtggacgtgttttcatcgcgccac
gtgcgcctgcgcctgttccacggccgcggcggctcggtgggacgcggcggcggctccagc
tttgacgccatcctggcgcagccgcccggcacggtcgccgggcagatccgcctgaccgag
caaggcgaagtcatccaaagcaagtacaaggacgccgaggttggccgctggcacctggaa
ctgctggtggccgccacgctggaatccagcctggccccgcgcgccgaagccaccagcgcg
gaagatgcgcacatggcgcagcacggcccggccatgtcgttcatgtctgacaccgcgcag
cgcacctatcgcggcctggtgtacgacacgccgcgctttgccgagtatttctttgccgcc
acgcccatcagtgaaatcgccggcctgaacatcggatcgcgtcctgcctcgcgcaagaag
ggccagcgcatcgaagacctgcgcgccattccgtggggcttttcgtgggcgcaatgccgc
ctgatgctgaccggctggtacggcatgggctcggccatcgaggcctatctggaagtgggc
gccgaaggcggcccgcgttcacgacgcgcgcggctggcgcaactgcgcgagatggcgcgc
gactggcccgcgttccgcacgctgctgtccaacatggaaatggtgctggccaagtccgac
ctggccatcgcggcgcgctatgcgcagctggtgccgcaacgcggcctgcgcgagcgcgtc
ttcgggctgatcagcgccgaacatggccgcacgctggccatgctgaaactgctgacccaa
cgcgagttgctggccgacaaccccacgctgcaagattccctgcgcgaacgttttgcgtat
atcgacccgctgaactacttgcagatcgacctgatccggcgccaccgcgcggcgcagaac
aatcccaaggcggaaatagacgaacgcgtgcagcgcgccatccacctgaccatcaacggc
atcgcggcgggcctgcgcaattccggctag

DBGET integrated database retrieval system