KEGG   Achromobacter sp. AONIH1: C2U31_02015Help
Entry
C2U31_02015       CDS       T05288                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00620  Pyruvate metabolism
achr00680  Methane metabolism
achr01100  Metabolic pathways
achr01120  Microbial metabolism in diverse environments
achr01200  Carbon metabolism
Module
achr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2U31_02015
  09102 Energy metabolism
   00680 Methane metabolism
    C2U31_02015
Enzymes [BR:achr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C2U31_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUT44844
UniProt: A0A2I8DDM6
LinkDB All DBs
Position
441878..444733
Genome map
AA seq 951 aa AA seqDB search
MNASSSRPQSDSAEPLRHDIRLLGRLLGTVIAECEGKRVFDTIETLRRTAVKFRREGNDA
DGKLLQERVKRLQGSDPNSVARAFSYFLHLSNIAEDRDQNRRQRARALADPAPSRGSLRE
TVQTLGRHGVGPARIRRLLAEACVMPVLTAHPTEVQRKSTLDEHREIAQALAHRDATLTP
EELAEIDATLLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQAIPRLYGDLSRLL
NRESAKPFAAPPPPLEPFLRMGSWIGGDRDGNPNVDAGTLERALLRQATVLFEHYLQEVH
ALGADLSMTTLLIAADPDLQALADHSGDDSPHRADEPYRRALVGVYARLAATAQVLTGQN
LARRSTVAAQAYDGPEAFAADLALVAKSLAAHHGAPIVRLRLAGLQQAVEVFGFHLATVD
LRQSSDVHERALAELFTRAGTQYQGQPLDYLALDEDARVALLRAELAQARPLASPWIAYS
EDTTRELAVLRAAAAGRARYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGAPIQ
DDDGLMVVPLFETIPDLQRGAAIMAAWLDLPEIRERVKRAQHGAQEVMLGYSDSNKDGGF
LTSNWSLYQAERALVDVFSARHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQLRL
TEQGEVIQSKYKDAEIGRWHLELLVAATLESSLAPRAEAASAEDAHMARHGQAMSFMSET
AQRTYRGLVYETPGFAEYFFASTPISEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQ
CRLMLTGWYGMGSAIEAYLETGAPGAPASRRARLAQLREMAREWPAFRTLLSNMEMVLAK
SDLAIAARYAQLVPKRALRERIFGAISAEHGRTLAMLKLLTQRELLADNPTLQASLRERF
AYIDPLNYLQIELIRRHRAAQRDPDAAVDERVQRAIHLTINGIAAGLRNSG
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccagcagcagccgcccgcagtccgattccgctgaacccttgcgtcacgatatc
cggctgttgggccggctgttggggacggtcatcgcggaatgcgagggcaagcgggtgttc
gacaccatcgagacgctgcgccgcaccgcggtgaaattccgccgcgagggcaacgacgcc
gacggcaagctgctgcaggagcgcgtcaagcgattgcagggcagcgacccgaactcggtg
gcgcgcgccttcagctacttcctgcatctgtccaacatcgccgaggaccgcgaccagaac
cgccgccagcgcgcccgcgccctggccgacccggcgccgtcgcgcggcagcctgcgcgag
accgtgcagacgctgggccgccacggcgtcggcccggcccgcatccgccgcctgctggcc
gaggcctgcgtgatgccggtgctgaccgcccaccccaccgaagtgcagcgcaagagcacg
ctggacgaacaccgcgagatcgcccaggcactggcccaccgcgacgccacgctcacgccc
gaggagctggccgagatcgacgccacgctgctgggccgcgtggccacgctgtggcagacc
cgcatgctgcgctacacccgtctgacggtggccgacgagatcgagaacgcgctgtcgtat
taccgcagcaccttcctgcaggcgattccgcgcctgtacggcgacctgtcgcgcctcttg
aaccgcgaatcggccaagcccttcgccgcgccgcccccgccgctggaaccgttcctgcgc
atgggcagctggatcggcggcgaccgcgacggcaatcccaacgtcgacgccggcacgctg
gaacgcgcgctgctgcgccaggccacggtgctgttcgaacactatctgcaggaggtccac
gcgctgggcgcggacctgtccatgaccacgctgctgattgccgccgacccggacctgcag
gcgctggccgaccacagcggcgacgattccccgcaccgcgccgacgagccctaccgccgc
gcgctggtcggcgtgtacgcccgcctggccgccaccgcccaggtcctgaccggccagaac
ctggcccgccgcagcaccgtggcggcccaggcctatgacggccccgaggccttcgccgcc
gacctggcgctggtcgccaagtcgctggccgcccaccacggcgcgcccatcgtgcggctg
cgcctggccgggctgcagcaggcggtggaagtatttggctttcacctcgccacggtggac
ctgcgccagagttccgacgtgcacgagcgcgcgctggccgaactgttcacccgcgccggc
acgcaataccaaggccagccgctggactacctggcgctggacgaggacgcgcgcgtggcg
ctgctgcgcgccgagctggcgcaggcgcgcccgctggcctcgccgtggatcgcgtacagc
gaggacaccacccgcgagctggccgtgctgcgcgccgccgcggccggccgggcgcgctac
ggcaagcaggcggtgcgccagaccatcgtgtcccacaccgagacgctgagcgacctgctg
gaagtgatggtgctgcagaaggaagccggcctgatcgcgccggccggcgcgccgatccag
gacgacgacggcctcatggtggtgccgctgttcgagaccattcccgacctgcagcgcggc
gcggccatcatggcggcctggctcgacctgcccgagatccgcgaacgcgtgaagcgcgcg
cagcacggcgcgcaggaagtcatgctgggctattccgacagcaacaaggacggcggcttc
ctgacctcgaactggtcgctgtaccaggccgaacgcgcgctggtggacgtattctccgcg
cgccacgtgcgcctgcgcctgttccacggccgcggcggctcggtgggacgcggcggcggc
tccagcttcgacgccatcctggcgcaaccgccgggcacggtggccggccagctgcgcctg
accgagcagggcgaagtgatccagagcaaatacaaggacgccgagatcggccgctggcac
ctggagctgctggtcgcggccacgctcgaatccagcctggcgccgcgcgccgaggccgcc
agcgccgaagacgcgcacatggcgcgccacggccaggccatgtccttcatgtccgagacc
gcgcaacgcacctatcgcggcctggtctacgaaacgccgggcttcgccgagtacttcttc
gcgtccacgcccatcagcgaaatcgccggcctgaacatcggctcgcgcccggcctcgcgc
aagaagggccagcgcatcgaagacctgcgcgccattccctggggcttctcatgggcgcaa
tgccggctgatgctgaccggctggtacggcatgggctcggccatcgaggcctatctggaa
accggcgcgccaggcgcccccgcctcgcgccgcgcgcggctggcgcagctgcgcgagatg
gcgcgcgagtggccggccttccgcacgctgctgtcgaacatggaaatggtgttggccaag
tccgacctggccatcgccgcgcgctacgcccagctggtgcccaagcgggcgctgcgcgag
cgcatcttcggcgccatcagcgccgagcacggccgcacgctggccatgctcaagctgctg
acccagcgcgagctgttggccgacaaccccaccctgcaagcttcgctgcgcgagcgcttc
gcgtacatcgatccgctgaactacctgcagatcgagctgatccgccgccatcgcgccgcc
cagcgcgatccggacgcggcggtggacgaacgcgtgcagcgcgccatccatctgaccatc
aacggcatcgcggcggggctgcgcaactcgggttga

DBGET integrated database retrieval system