KEGG   Achromobacter sp. AONIH1: C2U31_04175Help
Entry
C2U31_04175       CDS       T05288                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr01130  Biosynthesis of antibiotics
achr01230  Biosynthesis of amino acids
Module
achr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C2U31_04175
Enzymes [BR:achr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C2U31_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 TsaE AAA_16 Cytidylate_kin2 AAA AAA_25 AAA_5 APS_kinase Zeta_toxin AAA_7 NB-ARC AAA_23
Motif
Other DBs
NCBI-ProteinID: AUT45240
UniProt: A0A2I8DD86
LinkDB All DBs
Position
complement(914982..915623)
Genome map
AA seq 213 aa AA seqDB search
MNVSASSCPEADPDLAPSGEAPELQPCAAECAGKAVTLPHDLPVFLVGMMGAGKTTIGRS
LARALGRDFVDLDHELEARCGVRVPVIFEIEGEAGFRRRESAALEECTQRRNIILATGGG
AILAPENRQRLHERGIVVYLRASVDELFRRTCRDRNRPLLATADPKGTLRDLMTRREPYY
REVADLVVETGSTPIQTLVKGLLPQLQAFEKRI
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatccgcaagctcatgtccggaggctgacccggacctggcgccctccggcgag
gcgcccgaactccagccctgcgccgccgaatgcgccggcaaggccgtgaccctgccgcat
gacctgcccgtgttcctggtgggcatgatgggggcgggcaagacgaccataggccgcagc
ctggcgcgcgccttggggcgcgacttcgtcgatctggatcatgagctggaggcgcgttgc
ggcgtgcgtgtgccggtaatcttcgaaatcgagggcgaggccggtttccgtcgccgggaa
tccgccgcactggaagagtgtacccaacggcgcaacattattctcgccaccggcggcggc
gccatcctggcgccggaaaaccgccagcggctgcacgagcgcggcatcgtcgtctatctg
agggccagcgtggacgaattgttccgccgcacctgccgcgaccgcaaccgcccgctgctg
gccacggccgatcccaagggcacgctgcgcgacctgatgacccgccgcgagccttactac
cgcgaagtcgccgacctggtggtcgagaccggttccacgcccatccagaccctggtcaag
ggtctgttgccgcaattgcaagctttcgagaagcgcatatga

DBGET integrated database retrieval system