KEGG   Achromobacter sp. AONIH1: C2U31_11305Help
Entry
C2U31_11305       CDS       T05288                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00020  Citrate cycle (TCA cycle)
achr00480  Glutathione metabolism
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr01120  Microbial metabolism in diverse environments
achr01130  Biosynthesis of antibiotics
achr01200  Carbon metabolism
achr01210  2-Oxocarboxylic acid metabolism
achr01230  Biosynthesis of amino acids
Module
achr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
achr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U31_11305
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2U31_11305
Enzymes [BR:achr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C2U31_11305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUT46522
UniProt: A0A2I8DH76
LinkDB All DBs
Position
2453589..2454845
Genome map
AA seq 418 aa AA seqDB search
MSYQHIKVPAGGQKITVNADFSLNVPEQPIVPFIEGDGTGADITPVMIKVVDAAVQKAYG
GKRKIHWMEVYAGEKATKVYGPDVWLPEETLDVVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEYMAESEQAKELIQF
LQTKLGVKKIRFPATSSIGIKPVSREGTERLVRKALQYAIDNDRASVTLVHKGNIMKFTE
GGFRDWGYALAQKEFGAQLIDGGPWCKFKNPKTGREIIVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHMGWTEAADLIIASMEKSILSKKVTYDFARLLEGATQVSCSGFGQVMIDNM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcaacatatcaaggttcccgccggcggccagaagatcacggtcaatgccgat
ttctcgctgaatgtgcctgagcagcccatcgtgcctttcatcgaaggcgatggcactggc
gccgacatcacgccggtgatgatcaaggtcgtcgacgccgccgtgcagaaggcctacggc
ggcaagcgcaagatccactggatggaagtctatgcgggcgaaaaggccaccaaggtctat
ggtcccgacgtctggctgcccgaggaaacgctggacgtggtcaaggactacgtggtctcc
atcaaggggccgctgaccacgccggtgggcggcggcatccgttcgctcaacgtggccctg
cgccagcagctggacctgtatgtgtgcctgcgcccggtgcgctacttcaagggcgtgccc
tcgccggtgcgcgaacccgaaaagaccgacatggtgatcttccgcgaaaactcggaagac
atctatgccggcatcgaatacatggccgagagcgagcaggccaaggaactgatccagttc
ctgcagaccaagctcggcgtgaagaagatccgcttcccggccacctcgtccatcggcatc
aagccggtgtcgcgcgaaggcaccgagcggctggtgcgcaaggccctgcagtacgccatc
gacaatgaccgcgcctcggtcacgctggtgcacaagggcaacatcatgaagttcaccgaa
ggcggcttccgcgattggggctacgccctggcgcagaaggaattcggcgcgcagctgatc
gacggcggcccgtggtgcaagttcaagaacccgaagacgggccgcgagatcatcgtcaag
gactcgatcgccgacgccttcctgcagcagatcctgctgcgcccggccgagtacgacgtg
atcgccacgctcaacctcaacggcgactacgtctccgacgcgctggcggcgcaggtgggc
ggcatcggcatcgcgccgggcgccaacctgtccgactcggtcgccatgttcgaggccacg
cacggcaccgcgcccaagtacgcgggcaaggactacgtgaacccgggttcggaaatcctg
tcggccgagatgatgctgcgtcacatgggctggaccgaagccgccgacctgatcatcgcc
agcatggagaaatccatcctgtccaagaaggtcacctacgacttcgcccgcctgctggag
ggcgcgacccaggtgtcttgctcgggcttcgggcaggtgatgatcgacaatatgtag

DBGET integrated database retrieval system