KEGG   Achromobacter sp. AONIH1: C2U31_18765Help
Entry
C2U31_18765       CDS       T05288                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2U31_18765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:achr02000]
    C2U31_18765
Enzymes [BR:achr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C2U31_18765
Transporters [BR:achr02000]
 Other Transporters
  Pores ion channels [TC:1]
   C2U31_18765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C_3 GST_N_3 GST_C GST_C_2 Xpo1
Motif
Other DBs
NCBI-ProteinID: AUT47860
UniProt: A0A2I8DKW3
LinkDB All DBs
Position
complement(4080729..4081352)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGAEFDLVKLDIAAGQQQGPDYLRVNPKGRVPALATP
QGVLTETPALLAFVAQSFPAAGLAPLDDPFAFARMQELASYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKVPQTMTVCAAYLEAQIVGPWVAGERYSVVDGYLYTVGSWLEGDGVDMT
RFPKLTAYLERVGQREAVRRAVKEAQG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgctggaccttctacaccgctcccggcacttgcgccctggccacccacatcgcc
ttgcacgaagccggcgccgagttcgatctggtcaaactggacatcgccgccgggcagcag
caaggcccggactacctgcgcgtgaaccccaagggccgcgtacccgcactggccacgccc
cagggcgtgctgaccgagacccccgccctgctggccttcgtggcgcagagctttccggcg
gccggactcgcgccgctggatgatcccttcgccttcgcgcgcatgcaggaactggccagc
tacctggcctcgaccgcccacgtcgcccacgcccacaagcgccgcggcgcccgctgggcc
gacgatcccgccgcccatgaagccatgcgcgccaaggtgccgcagaccatgaccgtttgc
gcggcctatctggaagcgcagatcgtcgggccctgggtcgcgggggaacggtacagcgtc
gtggatggctatctgtataccgtcggcagctggctggagggggatggcgtggacatgacg
cggtttccgaagctgacggcgtatctggaacgggtgggtcagcgggaggcggtgcggcgg
gcggtgaaggaggcgcagggttga

DBGET integrated database retrieval system