KEGG   Achromobacter sp. AONIH1: C2U31_21500Help
Entry
C2U31_21500       CDS       T05288                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00564  Glycerophospholipid metabolism
achr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2U31_21500
Enzymes [BR:achr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2U31_21500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AUT48345
UniProt: A0A2I8DM50
LinkDB All DBs
Position
4697286..4698884
Genome map
AA seq 532 aa AA seqDB search
MNSTLASVTPPDRDRLLAQLDNTPAWDVIVIGGGATGLGTAVDAASRGYRTLLIEGADFA
KGTSSKATKLVHGGVRYLAQGNVSLVREALHERGLLNRNAPHLVWPLGFVVPAYNLLDQP
FYGIGLKMYDMLAGKLNLSPSRWLSRRDTLANAPTLAEQVNGRGLKGGVLYYDGQFDDAR
LAMSLMRTLFDLGGTAVNYVRATGLTMTNGKVDGVTATDALGDAVFTLRARCVINATGVW
VDAVRRMEDKNAPTMVAPSQGVHLTLPRDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRDDLPLDPDAGAQDVDFILGTAARYLSRKPTRDDVTSVWAGLRPLVKATGEASTK
TLSREHTILVSKAGLVTVTGGKWTTYRRMAQDVVNTAIQNQLLTQAPCRTESLALHGAAG
LSPSQEHAGTPDSYYGSDLPALKALPGAERMLVSASGLSEAHVRYAARYELARTAEDVLA
RRNRALFLDSEAAMLAAPEVARILAEELGHDAAWQQRTLRDLEPVAARYRLR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaattccactctcgcttccgtcaccccgcccgatcgcgaccgcctgctcgcccagctc
gacaacacgcccgcctgggacgtgatcgtcatcggcggcggcgccaccggcctgggcacc
gccgtggacgcggcctcgcgcggctaccgcacgctcttgatcgaaggcgccgacttcgcc
aagggcacgtccagcaaggccaccaagctggttcacggcggcgtgcgctacctggcgcag
ggcaatgtcagcctggttcgcgaagcgttgcacgagcgcggcctgctcaaccgcaacgcg
ccgcatctggtgtggccgctgggcttcgtcgtgccggcctacaacctgctggaccagccc
ttctatggcatcggcctgaagatgtacgacatgctggccggcaagctgaacctgtcgccc
agccgctggctgtcgcgccgcgacacgctggccaacgcgccgacgctggccgagcaggtc
aatggtcgcggcctgaagggcggcgtgctgtattacgacggccagttcgacgacgcgcgc
ctggccatgagcctgatgcgcacgctgttcgacctgggcggcacggcggtcaactacgtg
cgcgccaccgggctgaccatgacgaacggcaaggtcgacggcgtgacggccaccgacgcg
ctgggcgacgcggtcttcacgctgcgcgcgcgctgcgtgatcaacgccaccggcgtctgg
gtcgacgccgtgcgtcgcatggaagacaagaacgctcccaccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcgatttcctgccgggcaagcgcgccatcctgattccc
aagaccgacgacggccgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggc
accaccgacaccccgcgcgacgacctgccgctggatcccgacgccggcgcgcaggacgtg
gacttcatcctgggcacggcggcccgctatctgagccgcaagcccacccgcgatgatgtc
accagcgtctgggccgggctgcgccccttggtcaaggccaccggcgaggcatccaccaag
acgctgtcgcgcgaacacaccatcctggtgtccaaggccggcctggtcacggtcacgggc
ggaaaatggaccacctaccgccgcatggcgcaggacgtggtcaacacggccatccagaac
cagctgctgacgcaggccccctgccgcaccgagtcgctggccctgcacggcgccgccgga
ctgtcgccgtcgcaggaacacgccggcacgccggacagctactacggcagcgacctgccc
gcgctcaaggccctgccgggcgccgagcgcatgctggtcagcgccagcggcctgtccgaa
gcccatgtgcgctacgccgcccgctacgagctggcgcgcaccgccgaggacgtgctggcg
cgtcgcaaccgcgccctgttcctggacagcgaggccgccatgctggcagcgccggaagtc
gcccgtatcctggccgaggaactcggccacgacgccgcctggcagcagcgcacgctgcgc
gacctggaaccggtggcggcgcgctatcgcctgcgctga

DBGET integrated database retrieval system