KEGG   Achromobacter sp. AONIH1: C2U31_27850Help
Entry
C2U31_27850       CDS       T05288                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00010  Glycolysis / Gluconeogenesis
achr00071  Fatty acid degradation
achr00350  Tyrosine metabolism
achr00625  Chloroalkane and chloroalkene degradation
achr00626  Naphthalene degradation
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr01120  Microbial metabolism in diverse environments
achr01130  Biosynthesis of antibiotics
achr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2U31_27850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C2U31_27850
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    C2U31_27850
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C2U31_27850
   00626 Naphthalene degradation
    C2U31_27850
Enzymes [BR:achr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C2U31_27850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AUT50342
UniProt: A0A2I8DT72
LinkDB All DBs
Position
6110332..6111357
Genome map
AA seq 341 aa AA seqDB search
MDKTMKAAVARAFGKPLAIEEVAVPRPGAGELLVKIEACGVCHTDLHAVEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEQQQNAGYSV
NGGFAEYALAAADYVGLLPANIGFVDIAPVLCAGVTVYKGLKMTDTRPGNWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDAKLELARKLGAQVAVNARTTDPAAYLKREIGGAHGALI
TAVSPKAFEQALGMVRRGGTVALNGLPPGDFPLSIFDMVLNGVTVRGSIVGSRLDLQESL
QFAAEGKVRATVATERLENINHVFDRMRSGQIEGRVVLDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaccatgaaagccgccgtggccagggcgttcggcaagccgctggccatcgag
gaagtcgcggtgccccgacccggcgcgggcgagctgctggtgaagatcgaggcctgcggc
gtctgccataccgacctgcacgccgtggaaggcgactggccggtcaagcccaaccctccg
ttcattcccggccatgaaggcgtgggccatgtggtggccgtaggcgccggcgtcacccac
gtcaaggaaggcgaccgcgtcggcatcccttggctgtactccgcctgcggccattgcgag
cattgcctgggcggctgggaaacgctgtgcgaacagcagcagaacgccggctattcggtc
aacggcggcttcgccgaatatgcgctggccgcggccgactacgtggggctgctgcccgcc
aacatcggcttcgtggacatcgcgcccgtgctgtgcgccggcgtcaccgtgtacaagggc
ctgaagatgacagacacgcgcccgggcaactgggtggtgatctcgggcatcggcgggctg
ggccacatggcggtgcagtatgcccgcgccatgggcctgaacgtggcggccgtcgacatc
gacgacgccaagctggagctggcccgcaagctgggcgcccaggtggccgtcaacgcgcgg
accacggacccggccgcctacctcaagcgcgagatcggcggcgcccacggcgcgctgatc
accgccgtctcgcccaaggccttcgagcaggcgctgggcatggtgcggcgcggcggcact
gtcgcgctcaacggcctgccgcccggcgatttcccgctgtcgatcttcgacatggtgctc
aatggcgtgaccgtgcgcggatccatcgtcggctcgcggctggacctgcaggaatcgctg
caattcgccgccgagggcaaggtgcgcgccacagtcgcgaccgaacggctggagaacatc
aaccacgtgttcgaccgcatgcgcagcggccagatcgagggccgcgtggtgctggacttc
gcctga

DBGET integrated database retrieval system