KEGG   Acinetobacter baylyi: ACIAD0161Help
Entry
ACIAD0161         CDS       T00185                                 

Definition
(GenBank) conserved hypothetical protein; putative membrane protein
Organism
aci  Acinetobacter baylyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA HcyBio
Motif
Other DBs
NCBI-ProteinID: CAG67134
UniProt: Q6FFM3
LinkDB All DBs
Position
159232..160149
Genome map
AA seq 305 aa AA seqDB search
MNAILYALVVLIFGTTWIAIAVQQGEMSSVVAVFWRFCIAGLVLFLGLIVLKRLKKLTLE
DHLFCVLQGFCVFSLNFICFYTAVEFINSGLESVIFSLAVIFNAINSYLFFKQRISIYFI
PAMACGVVGVLALFWHDLTATHIDWKTILAILLCMLGTYGFSLGNMISLRHQRKGCDVLT
TNAYGMLYGAGIMLVITLTKGETFFAHTSWVAISAVGYLAIVGSVIGFSIYFVLVGRIGA
GQAAYSTLLFPLVALTISTFWENYQWTLSAGLGVVLILFGNFILFYQPQWVANSFKRLKI
FHLHQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatattatatgcattagtggttttgatttttggaacaacatggattgctatt
gcagtccagcagggggaaatgtcgtctgtagtcgcagttttctggcgattttgtattgca
ggtttggttctgtttttgggattaattgttttaaaacgcctaaaaaaactcactttagaa
gatcatctattttgtgttctacaaggtttttgtgtatttagcctgaactttatttgcttt
tataccgccgtagaatttattaatagtggtctagagtctgttattttttcactggcagtg
attttcaatgccatcaatagctatttgttttttaagcagcgtatttcgatttattttata
ccagccatggcatgcggtgtggtaggtgtcttggcgctgttttggcatgatttgacagcc
acacacattgactggaaaactattctggcaattttactgtgtatgttgggaacctatggc
ttttctttaggaaacatgattagcctgcgtcatcagcgtaaaggttgtgatgtacttacg
accaatgcttacgggatgttatatggcgctgggattatgctggtgattacactgacaaaa
ggagaaacattttttgcgcacacatcttgggttgcaatcagcgcagtaggatatctggcg
atagtcggttctgtcatcggttttagcatctattttgttctggtaggacgcattggtgca
gggcaggccgcttacagtaccttgttatttcctttggtggcattgactatttcaactttt
tgggaaaattatcaatggacattgagcgcagggctgggcgttgtactgattttatttggg
aattttattctgttttatcaacctcaatgggtagcaaatagttttaaaagattaaaaata
tttcatttacatcagtaa

DBGET integrated database retrieval system