KEGG   Acinetobacter baylyi: ACIAD1021Help
Entry
ACIAD1021         CDS       T00185                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aci  Acinetobacter baylyi
Pathway
aci00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACIAD1021
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACIAD1021
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACIAD1021
    1.1.1.-  
     ACIAD1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAG67911
UniProt: Q6FDE7
LinkDB All DBs
Position
1013095..1014210
Genome map
AA seq 371 aa AA seqDB search
MCKVIQFKGFQQSFKRKITMKAARFYDRGDIRIEDIPEPEVTAGTVGIQVAWCGICGTDL
HEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIQVGQHVVVEPYIVA
DDVPTGPGENYHLSKNMNFIGLGGRGGGLSEKIAVQRRWVHPISENIPLDQAALIEPLSV
GHHAYVRSGAKAGDVALVGGAGPIGLLLSAILKAKGLTVIITELSSKRKEKAKESGVADY
ILDPTQVDVIAEVMKITQDKGADIAFECSSVNKVLDTLVASTKPTGVIVIVSIWSHPATV
NVHSVVMKELDIRGTIAYVNDHQETIKLVEQGKINLAPFITQRIKLDDLISQGFETLIHN
NESAVKIIVHP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ctgtgtaaggtcatacagtttaaagggtttcaacaaagttttaaaaggaagataacaatg
aaagcagcacgtttttatgatcgtggcgacatccgtattgaggatattcctgagcctgaa
gtaacggcaggaacagtgggcatacaggtggcgtggtgtgggatctgtggaacagattta
cacgagtttatggaaggcccgatttttattccaccatgtggacatccgcatccaatttcg
ggagagtcagcacctatcaccatgggccatgaattttcgggtgtggtatacgctgtgggt
gaaggcgtagatgatattcaggtaggccagcatgtggtggtcgagccatatatcgtggca
gatgatgttccaacaggtcctggtgaaaattatcatctttctaagaatatgaactttatt
ggtctgggtggtcgtggtggtggcttatcggaaaagattgcagtccagcgccgttgggta
catccaatttcagaaaatattccacttgatcaagccgcattaattgaaccactctctgtc
ggacatcatgcctatgttcgaagtggtgcgaaagcaggtgacgtggcattggtgggcggc
gcaggcccgattggtctactgctctctgcaattttaaaggccaaaggtttgacggttatc
attaccgaattaagcagcaagcgaaaagaaaaagccaaagaatctggcgttgcggactat
attctcgatccgactcaagtcgatgtgattgcagaagtcatgaaaattacgcaggacaaa
ggtgcagacattgcatttgagtgcagcagtgtgaataaagtattagacacactggttgct
tcaacaaaaccaacaggtgttattgtcattgtatcgatctggagccaccctgcaaccgta
aatgtacatagtgtggtgatgaaagagctggatattcgcggaacaattgcctatgtcaat
gatcatcaggaaacgattaaactggtcgaacaaggtaaaattaatctggcgccgtttatt
acgcagcgcattaaattagatgatctgatttctcaaggatttgagacattgatccataac
aatgaatcggctgttaaaattattgtgcatccttaa

DBGET integrated database retrieval system