KEGG   Acinetobacter baylyi: ACIAD1234Help
Entry
ACIAD1234         CDS       T00185                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding, detoxification of hydroperoxides
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aci  Acinetobacter baylyi
Brite
KEGG Orthology (KO) [BR:aci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACIAD1234 (ahpF)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACIAD1234 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 FAD_oxidored FAD_binding_3 NAD_binding_8 Glutaredoxin DAO Glucosamine_iso AlaDh_PNT_C K_oxygenase Shikimate_DH Cytochrom_C_2 FMO-like
Motif
Other DBs
NCBI-ProteinID: CAG68109
UniProt: Q6FCV0
LinkDB All DBs
Position
complement(1234047..1235606)
Genome map
AA seq 519 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDDSDKAAKIKELVTEIAELSNQVTARFDGQNTR
RPSFGIAKAGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEILNQIKGLNLKADF
DVFVSLSCHNCPDVVQALNLIAIYNPNSTATMIDGAFFQDEVEERKIMAVPMVFQNGNHI
GQGRMTLEEIVAKLDSNAAEKDAAAINAKDVFDVLVVGAGPAGGTAAIYAARKGIRTGMI
AERFGGQVMDTMDIENFTSVQKTVGPKFAADMEAHVREYDVDIMNLQRVSKIVGADQTAS
GLVEVELENGAKVESKTVILSTGARWRKMGVPGEQEYATRGVAYCPHCDGPLFKGKKVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNATIITNALSTEVIGD
GAQVTGLKYKDRATDTEHTIELAGIFVQIGLLPNTDFLKGSVELSPRGEIIINERNETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRHG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaatatcaaaactcaacttaaagcttatttagaacgtttggaaagccca
attgaattggtcgctgcactcgatgactcagacaaagctgccaaaatcaaagaactggtc
actgaaattgcagaactctccaaccaggtgacagcacgttttgatggtcagaatacacgc
cgtccaagtttcggtattgccaaagccggtgaacaacctcgtgtgttctttgcaggcttg
ccgatgggtcatgagtttacctcactcattctggcattgttacaaacctcaggttatgca
cctaaagtgtctgatgaaatcttaaaccagattaaaggccttaacttaaaagctgatttt
gatgtgtttgtttctttaagctgtcataactgtccagatgtggtccaggcgttaaacttg
attgcgatctataatccaaacagtactgcgaccatgattgatggggctttctttcaggat
gaagttgaagaacgcaaaatcatggccgtaccaatggtgttccagaatggcaatcacatc
ggtcagggtcgtatgacgctagaggaaattgtcgcgaaactggacagcaatgctgctgag
aaagatgccgctgccattaatgcaaaagatgtctttgatgtattggtcgtaggtgctggt
cctgctggtggtactgccgcgatctatgcagcacgtaaaggtattcgtactggtatgatt
gccgagcgctttggtggtcaggtgatggacaccatggacattgaaaatttcacctctgta
caaaaaacggtggggccaaagtttgctgcggatatggaagcacatgttcgtgaatatgat
gttgatatcatgaatttgcaacgtgtcagtaagattgtgggtgcagatcaaactgcttca
ggtctggttgaagttgaactggaaaatggggctaaggttgaatcgaaaaccgtgatttta
tcgacgggtgcgcgctggagaaaaatgggggttcctggtgagcaggaatatgccactcgt
ggtgtcgcatattgcccacactgtgatggtccattgtttaaaggcaagaaagttgcggtg
attggtggaggtaactcgggtgtcgaagctgcaattgatttagcaggaattgttgagcat
gtaacgctggtggaatttgataccaaacttcgtgcagaccaggtattgcaggacaagcta
aatagtttgccaaatgcgaccattattaccaatgcactttctacagaggtgatcggtgat
ggtgctcaagtgacgggtttgaagtataaagaccgtgcgacagatacagaacacacgatt
gagctggcagggatttttgtacagattggcttgttaccaaacactgactttcttaaaggt
tcggtagagttaagcccacgaggtgagatcatcatcaatgagcgcaatgaaaccaatgtg
aagggtgtgtttgcagcaggtgactgtaccacagtgccgtacaagcagatcatcattgcc
acaggtgaaggtgccaaagcgtctctgtctgcttttgattatattattcgtcatggctga

DBGET integrated database retrieval system