KEGG   Acinetobacter baylyi: ACIAD1878Help
Entry
ACIAD1878         CDS       T00185                                 

Gene name
aro
Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase (DAHP synthetase), tyrosine repressible
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
aci  Acinetobacter baylyi
Pathway
aci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01130  Biosynthesis of antibiotics
aci01230  Biosynthesis of amino acids
aci02024  Quorum sensing
Module
aci_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACIAD1878 (aro)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACIAD1878 (aro)
Enzymes [BR:aci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ACIAD1878 (aro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CAG68707
UniProt: Q6FB56
LinkDB All DBs
Position
complement(1870386..1871441)
Genome map
AA seq 351 aa AA seqDB search
MNALNTLIQKNTTKEITLSLPQQLKAKYSLAPIFLEQIAEHRQTIQNILAGKDSRLLVVT
GPCSIHDPVSALQYAQRLVKLQDQVKDQIFLVMRAYLEKPRTTIGWKGFLYDPNLDGSSD
LQLGLEKSRALYLQIIEMGLPIASEILSPMATGYFDDLLAWGAIGARTSESQIHREISSH
MPFPIGFKNGTDGSIQIALDAIQSAQNEHQFLGMSQLGQPAILQSSGNPLPHLILRGAND
GPNYDIQSISNIRAKHKGELPALVIDCSHGNSSKDPMKQPQVLRQIIAERIESDVRGVML
ESHLVDGNQKISCDITYGQSVTDGCLGWEKTENLLLEMADQLAQCPLRQSA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcttaatacattgatccagaaaaatacgacaaaagaaattacacttagcttg
ccacagcaattaaaagcaaaatattcgcttgctcccatttttttagagcagatcgcagag
catcgtcaaaccattcaaaatatccttgctggcaaagattcacggcttttggtcgtaact
ggtccatgttcgattcatgatcctgtttctgcgctgcaatacgcacaaaggcttgtcaaa
ttacaagatcaagttaaagatcagatttttttagtgatgcgtgcttatctcgaaaaacca
cgtacaacaattggctggaagggttttttatacgatccaaatcttgatggttcatcagat
ttacagctgggtttagaaaaatctcgcgcattatatttgcaaattattgaaatggggctt
ccaattgccagtgaaattttaagcccaatggcgactggctattttgatgatttactggct
tggggagctattggggcacgtaccagtgaatctcagattcatcgtgaaatttcaagtcat
atgccgtttccaattggttttaaaaatggtactgatggttcgattcagatcgcattggat
gccattcaatctgcacaaaatgaacatcagtttttagggatgagtcagcttggccagcct
gcaattttacaaagttctgggaatccactgccgcatttgatcttgcgtggagcaaatgat
ggaccaaattatgatattcagtccatttcgaatattagagcaaaacataagggcgaatta
cctgcgcttgtaattgactgtagtcatggcaatagttcaaaagatccgatgaaacaaccg
caagtacttcgacaaatcattgcagaaagaattgaaagtgatgttcgaggtgtgatgttg
gaaagccatttggtcgatggaaatcagaagatttcatgcgacataacctatggccaatct
gtgactgatggttgccttgggtgggagaagacagagaatttacttttagaaatggctgat
caactcgcacaatgtcctttacgccaatcagcttaa

DBGET integrated database retrieval system