KEGG   Acidilobus sp. 7A: SE86_07090Help
Entry
SE86_07090        CDS       T05595                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
acia  Acidilobus sp. 7A
Pathway
acia03030  DNA replication
acia03410  Base excision repair
acia03420  Nucleotide excision repair
acia03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SE86_07090
   03410 Base excision repair
    SE86_07090
   03420 Nucleotide excision repair
    SE86_07090
   03430 Mismatch repair
    SE86_07090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acia03032]
    SE86_07090
   03400 DNA repair and recombination proteins [BR:acia03400]
    SE86_07090
Enzymes [BR:acia01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SE86_07090
    6.5.1.6  DNA ligase (ATP or NAD+)
     SE86_07090
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SE86_07090
DNA replication proteins [BR:acia03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SE86_07090
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SE86_07090
DNA repair and recombination proteins [BR:acia03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SE86_07090
   NER (nucleotide excision repair)
    Other NER factors
     SE86_07090
   MMR (mismatch excision repair)
    Other MMR factors
     SE86_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C CdAMP_rec DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AMD31398
UniProt: A0A120K5K7
LinkDB All DBs
Position
1406401..1408206
Genome map
AA seq 601 aa AA seqDB search
MPFEEVANAFSSMEGVTSRIQLTQLLAGLLKRTPADVIDKVVYMIQGKLGPDWKGIPELG
VGDKLLVQSMAMAYGKSESDVQRLVDKLGDPGKVAEQLAQTGGHIKSSLLAFMGGASEQL
TVSRVFDSFMKIAYATGESSRDLKLKTLAGLLKDAKPIEARYIVRFVEGRLRLGIGDATI
LDALSVAYGGTTAVRDVVERAYNLRADLGEIARIVAQQGVEALKGLKPEVGTPIRPMLAE
RASDAKEILAKVGGRAYVEYKYDGERGQIHKDGDKVKIFSRRMEDITSMYPDVVEGVKDA
IKAERAIIEGEIVAIDPDTGELRPFQELMQRRRKYDIDKMMKEIPTRLFLFDIMMKDDED
LTTKPLPYRRKVLESIVQPNERVVMSNYIESSDPDEIMNFFLQAISDGAEGVMIKAIHDE
STYRAGVRGWLWVKLKRDYRSEMTDTVDLVVVGAFYGKGKRGGKLGTLLLAAYDPDNDVF
KTVCKVGTGFTDADINGMYDMFKPHIIDHRHPRVISSIEADVWLEPVKVAEVIGAELTLS
PAHTCCMDTIRKGAGISIRFPRFIRWRDDKGPEDATTEQELLEMYKRQLKKVEEKSTESE
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaggaggtagctaatgccttcagctccatggagggcgtaacttcaagaatt
cagctaacccagctgcttgcaggcctccttaagaggacgccggccgacgtaattgataaa
gttgtttacatgatacagggcaagctagggcctgactggaagggcataccggagctcggc
gtcggcgacaagctgctggtgcaatccatggctatggcttatggcaagagcgaaagcgat
gttcagaggttggtcgataagctgggcgaccctggcaaggtcgctgagcagttggcccag
acgggaggacacatcaagagcagcctcctggcgtttatgggaggcgcttcggagcagctc
acagtgagcagggtcttcgactcattcatgaagatagcctatgccacaggggagagcagc
agggacctgaaacttaagaccctggctgggctcctcaaggacgctaagcccatagaggcc
aggtacatagtgaggttcgtcgagggcaggctaaggctcgggataggggatgctacaata
cttgacgctctctcggtggcctatgggggcacgacagctgtcagagatgtggttgagagg
gcctacaacctgagggcggacctgggcgagatagctaggatagtcgcccagcagggcgtt
gaggctctcaagggtctcaagcctgaggtggggacgcccataaggccgatgctagccgag
agggccagcgacgccaaggagatactggctaaggtgggcggtagggcctatgtggagtat
aaatacgatggtgagaggggccagatacataaggacggcgacaaggtgaagatattctca
aggagaatggaggatataacgtcgatgtaccctgacgtcgtggagggcgttaaggacgca
ataaaggctgagagggctataatcgagggcgagatagttgccatagatcctgacacaggg
gagctgaggccgttccaggagctcatgcagaggaggaggaagtacgacatagacaagatg
atgaaagagatacctacgaggctattcctctttgacataatgatgaaggacgacgaggac
ctcactaccaaaccattgccctacaggaggaaggtgcttgagtccatagtgcaacctaac
gagagggtagtaatgagcaactacatagagagctccgacccggacgagataatgaacttc
ttccttcaggccatatcagatggcgccgagggcgtcatgataaaggctatacatgatgag
agcacatacagggccggtgtgaggggctggctctgggtcaagcttaagcgtgactacagg
agcgagatgaccgacaccgtcgacctggtggtggttggggcgttctacgggaagggcaag
cgcggcggcaagctgggcacgctgttgctggcagcgtatgaccctgacaacgacgtcttt
aagaccgtctgcaaggtggggaccggcttcacagatgccgacattaacggcatgtacgat
atgtttaagccgcacataatagatcacaggcacccaagggtcatctcatcgatagaggct
gacgtgtggcttgagccagtgaaggtggctgaggttataggcgccgagctcacgttgtcc
ccggcccatacgtgctgcatggataccataaggaagggcgccggcatatcgataaggttc
ccaaggtttataaggtggagggacgataaaggacctgaggacgcgactacggagcaggag
ctgctggagatgtataagaggcagctgaagaaagttgaggagaagtccacggagtcagag
gcgtaa

DBGET integrated database retrieval system