KEGG   Acidovorax carolinensis NA2: CBP33_00915Help
Entry
CBP33_00915       CDS       T04914                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00473  D-Alanine metabolism
acid01100  Metabolic pathways
acid01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBP33_00915
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CBP33_00915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acid01011]
    CBP33_00915
Enzymes [BR:acid01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CBP33_00915
Peptidoglycan biosynthesis and degradation proteins [BR:acid01011]
 Precursor biosynthesis
  Racemase
   CBP33_00915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ART49919
UniProt: A0A240TWB5
LinkDB All DBs
Position
196238..197353
Genome map
AA seq 371 aa AA seqDB search
MPRPIHATIHTAALQHNLERVRQAVPDAKTWAVVKANAYGHGIERAFEGLRAADGFALLD
LAEAERVRHLGWRGPILLLEGVFEPRDLELCSRLSLWHAVHCDEQIDMLAAHKTQVPHRV
FLKLNSGMNRLGFTAQRYRSAWARLNALPQVDEISFMTHFSDADGARGVAHQMAAFNAAT
QDLPGERSVCNSAATLRFASDAQVRGDWVRAGIVLYGSAPDFPAHNADHWQVQPTMTLAT
RIIGTQQLQAGDTVGYGSRFTAEGPLTIGVAACGYADGYPRHCDTGTPVLVNGVRTRLVG
RVSMDMVTVDLSPVIAAGVDAGFGSEVTLWGSARNGAVLPIDEVAQAAGTVGYELMCALA
PRVPVAVDGVA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatccacgccaccatccataccgctgccctgcaacataatctggagcgc
gtgcgccaggccgtgcccgacgccaaaacctgggccgtggtcaaggccaacgcgtatggg
cacggtattgaacgggcctttgaaggcctgcgcgccgccgatggttttgcgctgctcgac
ctggccgaggccgagcgcgtacgccatctgggctggcgggggcccatcctgctgctggag
ggcgtgttcgagccgcgcgatctggagctgtgctcgcgcctgtcgctgtggcatgccgtg
cactgcgacgagcagatcgacatgctggccgcccacaagacgcaggtgccgcaccgcgtg
ttcctcaagctgaactcgggcatgaaccgcctgggcttcacggcgcagcgctaccgcagc
gcctgggcgcgcctgaacgcgctgccgcaggtggatgaaatttcgttcatgacccatttc
agcgatgccgacggagcgcgcggcgttgcgcaccagatggcggccttcaacgcggccacg
caagacctgcccggtgagcgcagtgtctgcaacagcgccgccacgctgcgtttcgccagc
gacgcccaggtgcggggcgactgggtgcgcgcgggcatcgtgctgtatggcagcgcgccc
gattttccggcccacaacgccgaccattggcaggtgcagcccaccatgacgctggccacc
cgcatcatcggcactcagcagctgcaggcgggtgacaccgtgggctatggctcgcggttc
acggccgaggggccgctcaccatcggcgtggccgcctgtggttatgccgatggctacccg
cgccattgcgacaccggcacgcccgtgctggtgaacggcgtgcgcacgcgcctggtgggc
cgcgtcagcatggacatggtcacggtggacctgagccccgtgattgcggctggtgtggac
gccggtttcggcagcgaggtcacgttgtggggcagcgcccgcaatggcgccgtgctgccc
atcgacgaggtggcgcaggctgctggcaccgtgggctacgagctgatgtgcgcgctggcg
ccgcgcgtgcctgtggcggtggacggcgttgcctga

DBGET integrated database retrieval system