KEGG   Acidovorax carolinensis NA2: CBP33_00935Help
Entry
CBP33_00935       CDS       T04914                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP33_00935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acid02000]
    CBP33_00935
Enzymes [BR:acid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBP33_00935
Transporters [BR:acid02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBP33_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_C_2 GST_N_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ART46876
UniProt: A0A2C9NTW6
LinkDB All DBs
Position
complement(201434..202045)
Genome map
AA seq 203 aa AA seqDB search
MSAPTLYLAPGTCALAVHIALHEARAGHELVRLDFAAQQQRSPEYLAINPKGRVPALVTE
HGVLTETPALLAYVAQRYAQGQLAPLDPFAFARMQEFNSYLASTVHVAHAHGRRGSRWAD
DPASHADMLRKVPQTMAECFGVIEDHYLQGPWVLGEQYSVADAYLFTLSGWLRSDGVDVA
QFPKVADHRRRMAERPAVQRALA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccacgctgtacctcgctcccggcacctgcgccctggccgttcacattgcc
ttgcacgaggcccgggcaggccacgaactggtgcgcttggactttgccgcccagcagcaa
cgcagccccgaatacctggccatcaaccccaagggccgcgtgcctgccttggtgaccgag
cacggcgtgctgaccgaaaccccggcgctgctggcctatgtggcccagcgctacgcccag
gggcagctggcgccattggatccgtttgccttcgcacgcatgcaggagttcaacagctac
ctggcctccaccgtccatgtggcccacgcccacgggcggcgcggcagccgctgggcagac
gatcccgcctcccatgccgacatgctgcgtaaagtcccgcagaccatggcggagtgcttt
ggcgtgatcgaagaccactacctgcaaggcccttgggtgctgggagagcaatattccgtt
gccgatgcctacctgttcaccctgtccggctggctgcgcagtgatggcgtggacgtggcg
cagtttcccaaggtggccgaccaccggcgccgcatggccgagcggcctgccgtccagcgc
gcgctggcctga

DBGET integrated database retrieval system