KEGG   Acidovorax carolinensis NA2: CBP33_01340Help
Entry
CBP33_01340       CDS       T04914                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
acid  Acidovorax carolinensis NA2
Brite
KEGG Orthology (KO) [BR:acid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:acid03012]
    CBP33_01340
   03029 Mitochondrial biogenesis [BR:acid03029]
    CBP33_01340
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acid04147]
    CBP33_01340
Translation factors [BR:acid03012]
 Eukaryotic Type
  Elongation factors
   CBP33_01340
 Prokaryotic Type
   CBP33_01340
Mitochondrial biogenesis [BR:acid03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBP33_01340
Exosome [BR:acid04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBP33_01340
  Exosomal proteins of breast cancer cells
   CBP33_01340
  Exosomal proteins of colorectal cancer cells
   CBP33_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ART46937
UniProt: A0A240TP72
LinkDB All DBs
Position
279828..281018
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETAARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYNFPGDDTPIIRGSAKLALE
GDKGPLGEEAIMKLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIKDTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgaacgcaccaagccccacgtcaacgtgggcacgatcggtcac
gtggaccatggcaagacgacactgacggcggccattgccaccgtgctgtcggccaagttt
ggcggcgaagccaaggcctacgaccagatcgacgcagcgcctgaagaaaaggcccgcggc
atcacgatcaacaccgcgcacgtggaatacgaaacggctgctcgccactacgcccacgtg
gactgccctggtcacgccgactatgtgaagaacatgatcaccggcgctgcccagatggac
ggcgccattttggtgtgctcggccgctgacggccccatgccccagacccgcgaacacatc
ctgctggcccgccaggtgggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagaactgctcgaactcgtcgaaatggaagtgcgcgaactgctggacaaa
tacaacttccctggcgacgacaccccgatcatccgtggttccgccaagctcgccctcgaa
ggcgacaagggcccgctgggcgaagaagccatcatgaagctggccgaagcgctggacacc
tacatccccacgcctgagcgcgctgtggacggtgccttcctgatgcctgtggaagacgtg
ttctccatctctggccgcggcaccgtggtgaccggccgtatcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggacaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagacgtggaacgcggccaagtgctgtgcaagcccggctcg
atcaagccccacacccactttaccgctgaagtgtatgtgctgagcaaggacgaaggcggc
cgccacacccccttcttcaacaactaccgccctcagttctacttccgcacgaccgacgtg
accggcgccatcgagctgccagccgacaaggaaatggtcatgcctggcgacaacgtgtcg
atcaccgtgaagctgatcaaccccatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggcggccgcaccgtgggcgctggcgtcgtggccaagatcattgcttaa

DBGET integrated database retrieval system