KEGG   Acidovorax carolinensis NA2: CBP33_09370
Entry
CBP33_09370       CDS       T04914                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid03030  DNA replication
acid03430  Mismatch repair
acid03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acid00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CBP33_09370
   03430 Mismatch repair
    CBP33_09370
   03440 Homologous recombination
    CBP33_09370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acid03032]
    CBP33_09370
   03400 DNA repair and recombination proteins [BR:acid03400]
    CBP33_09370
Enzymes [BR:acid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CBP33_09370
DNA replication proteins [BR:acid03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CBP33_09370
DNA repair and recombination proteins [BR:acid03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CBP33_09370
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: ART48306
UniProt: A0A240TRT1
LinkDB
Position
1977326..1977760
AA seq 144 aa
MTEIAFHFNAPDKMAYACRFARKAQRSGARLVITGPADTLSVLDGMLWSMMPQDFVAHCR
GDAEDELLQFSSVVLAVDVQQAPHQEMLLNMGDAVPEGFGSFDRLVEVVSATDEVDRNEA
RARWRHYASRGYAITRHDLVLKAD
NT seq 435 nt   +upstreamnt  +downstreamnt
atgactgaaatagctttccacttcaatgcgccggacaaaatggcctatgcctgtcggttt
gctcgcaaagcgcaacgcagtggtgcacggcttgtcatcacgggtcctgcggacacactg
tctgtgctggacggaatgctgtggagcatgatgccgcaggatttcgttgcccattgccgt
ggcgatgcggaggacgaactcttgcaattttcatcggtggtacttgccgtggatgtgcag
caagcaccccatcaagagatgctgctgaatatgggtgatgctgtgcctgaagggtttggc
agttttgaccggttggtggaggtggtgagtgccacagatgaggtagatcgcaatgaagcg
cgtgcccgctggcgtcactatgcgtcacggggctatgccatcacgcgccatgatctggtg
ttgaaagccgattga

DBGET integrated database retrieval system