KEGG   Acidovorax carolinensis NA2: CBP33_09450Help
Entry
CBP33_09450       CDS       T04914                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00020  Citrate cycle (TCA cycle)
acid00480  Glutathione metabolism
acid01100  Metabolic pathways
acid01110  Biosynthesis of secondary metabolites
acid01120  Microbial metabolism in diverse environments
acid01130  Biosynthesis of antibiotics
acid01200  Carbon metabolism
acid01210  2-Oxocarboxylic acid metabolism
acid01230  Biosynthesis of amino acids
Module
acid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acid_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBP33_09450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP33_09450
Enzymes [BR:acid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBP33_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ART48322
UniProt: A0A240TRS4
LinkDB All DBs
Position
1990888..1993125
Genome map
AA seq 745 aa AA seqDB search
MSTQQPTIIYTLTDEAPRLATASFLPIVRAFAAPAGINVTESDISVAARVLGEFPEFLRD
DQKVPNTLAALGKKTLEPDANIIKLPNISASVGQLISCIKELQGKGYAVPDYPEDPKTEE
DKAIRARYAKCIGSAVNPVLREGNSDRRAPRAVKEYARKNPHSMAEWSQASRSHVSHMHH
GDFYHGEKSMTLDKARDVKMELITKSGKTIILKPKVSLLDREIIDSMFMSKKALLEFYEK
EIEDAHKTGVMFSLHVKATMMKVSHPIVFGHCVKIFYKDAFAKHGKLFDELGVNVNNGMA
NLYEKVATLPTAQREEVLKDLHACHASRPELAMVDSAKGITNFHSPNDIIVDASMPAMIR
NGGKMWGADGRLKDVKAVMPESTFARIYQEIINFCKWHGAFDPKTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEDGVANITDLTTGEVLLSQNVEAGDIWRMCQVKDAAIRDWVKLAVNRA
RNSGMPVVFWLDAYRPHEAQLITKVKMYLHEHDIAGLDIQIMSQVRAMRYTLERVVRGLD
TISATGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEDLGLKTGNAQAKVLAKTLDAATGKLLDNNKNPSPKTGQLDNR
GSQFYLALYWAQELAAQTDDADLAKRFAPLAQQLAANEQKIVDELNAVQGKAADIGGYYL
PDLAKLDAVMRPSQTLNTVLAAAGA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccagcaacccaccatcatctacaccctgaccgatgaggcgcctcgcctggcc
acggcttccttcctgcccatcgtgcgcgcctttgccgcgcctgcgggcatcaacgtgacc
gaaagcgacatctctgtggcggcccgcgtgctgggtgagttccccgagttcctgcgcgac
gaccagaaggtgcccaacacgctggccgctttgggcaagaagaccctggagcccgatgcc
aacatcatcaagctgcccaacatcagcgcgtcggtaggccagctgatctcctgcatcaag
gaactgcagggcaagggttatgccgtgcccgactaccctgaagatcccaagaccgaagaa
gacaaggcgatccgcgcgcgctatgccaagtgcatcggcagcgctgtgaatcccgtgctg
cgcgagggcaactccgaccgccgcgcgccccgggccgtcaaggaatacgcacgcaagaac
ccgcacagcatggccgagtggagccaggcgtcgcgctcgcatgtctcgcacatgcaccac
ggtgacttctatcacggcgaaaaatcgatgacgctggacaaagcgcgcgacgtgaagatg
gagctgatcaccaagagcggcaagaccatcatcctcaagcccaaggtgtcgctgctggac
cgcgagatcatcgacagcatgttcatgagcaagaaggccttgctcgagttctacgagaag
gaaatcgaagacgcacacaagacgggcgtgatgttctcgctgcacgtcaaggccacgatg
atgaaggtgtcgcaccccatcgtgttcggccactgcgtgaagatcttctacaaggacgcg
tttgccaagcacggcaagctgtttgacgagctaggcgtgaacgtgaacaacggcatggcc
aacctctacgaaaaagtggccacattgcccaccgcacagcgcgaagaagtgctgaaagac
ctgcatgcctgccacgccagccgccccgagctggccatggtggactcggccaagggcatc
accaacttccactcgcccaacgacatcatcgtggacgcatccatgcccgccatgatcagg
aacggcggcaagatgtggggcgccgacggccgcctgaaggacgtcaaggccgtgatgccc
gaatcgacctttgcccgcatctaccaggagatcatcaacttctgcaaatggcacggcgcg
tttgaccccaagaccatgggcacggtgcccaacgtcggcctgatggcccagcaggccgag
gaatacggctcgcacgacaagacgtttgaaatccccgaagacggcgtggccaacatcacc
gacctgaccactggcgaagtgctgctctcccagaacgtggaagccggcgacatctggcgc
atgtgccaggtcaaggatgccgccatccgcgactgggtcaagctggctgtcaaccgcgca
cgcaactcgggcatgcccgtggtgttctggctcgacgcctaccgtccacatgaggcccag
ctgatcaccaaggtcaagatgtacctgcacgagcacgacattgccggcctcgatatccag
atcatgagccaggtgcgtgcgatgcgttacacgctcgagcgcgtggtgcgcggcctggac
accatcagcgccaccggcaacatcctgcgcgactacctcaccgacctgttccccatcatg
gaactgggcacctcggccaagatgctgtccatcgtgcctttgatggccggtggcggcatg
tacgaaaccggtgcgggcggctcggcccccaagcatgtgcagcagctggtggaagaaaac
cacctgcgctgggactcgctgggcgagttcctggcgctggccgtgtcgctggaagacctg
ggcctgaaaaccggcaacgcgcaggccaaggtgctggccaagacgctggacgccgccacc
ggcaaactgctggacaacaacaagaacccctcgcccaagaccggccagctcgacaaccgt
ggcagccagttctacctggccttgtactgggcgcaagagctggccgcgcagaccgacgat
gccgacctggccaagcgctttgccccgctggcccagcaactggccgccaacgagcaaaag
atcgtggacgagctcaatgccgtgcagggcaaggccgccgacattggcggctattacctg
cccgatctggccaagctcgatgccgtgatgcggcccagccagaccctgaacacggtgctt
gccgccgctggcgcctga

DBGET integrated database retrieval system