KEGG   Acidovorax carolinensis NA2: CBP33_09860Help
Entry
CBP33_09860       CDS       T04914                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acid  Acidovorax carolinensis NA2
Brite
Enzymes [BR:acid01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CBP33_09860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: ART48396
UniProt: A0A240TS19
LinkDB All DBs
Position
2085950..2086471
Genome map
AA seq 173 aa AA seqDB search
MSLHNVFLSAAMVASLAGCAAYSSGPSATAKLEPTRGNAAAGTVTFVQSGEAVKVSGSIT
GLKPGAEHGFHIHEKGDCSSGDGLSAGGHFNPGGKPHGHHGMGEHHTGDLPSLKADANGV
AAFNFESRTIRVGSSANDIVGKGLIVHRDPDDYQTQPTGNAGPRLACAVITAK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgcacaacgttttcctatcggccgccatggtggcctcgctggccggctgcgcc
gcgtattcgtcgggccccagcgccacggccaaactggagcccacgcgcggcaacgccgct
gcgggcaccgtgacgtttgtccagtcgggcgaggcggtgaaggtgtcgggttccatcacc
ggcctcaagccgggtgccgagcacggttttcacatccacgagaaaggcgattgctccagc
ggtgacggcctgagcgccggcggccacttcaaccccggtggcaaaccacatggccaccat
ggcatgggcgagcaccacacgggcgacctgcccagcctcaaggccgatgccaatggcgtg
gctgcattcaactttgaatcgcgcacgatccgcgtgggcagcagcgccaacgacatcgtg
ggcaaaggcctgatcgtgcaccgcgacccggacgactaccagacccagcccaccggcaat
gccggcccgcgcctggcctgcgccgtcatcacggccaagtaa

DBGET integrated database retrieval system