KEGG   Acidovorax carolinensis NA2: CBP33_12995Help
Entry
CBP33_12995       CDS       T04914                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acid  Acidovorax carolinensis NA2
Brite
KEGG Orthology (KO) [BR:acid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBP33_12995
Enzymes [BR:acid01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBP33_12995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ART48923
UniProt: A0A240TUU2
LinkDB All DBs
Position
complement(2785201..2786769)
Genome map
AA seq 522 aa AA seqDB search
MLDEQLKTQLSAYLERVQQPFELVASLDDSDTAREMLDLLQTIQSLRSDKITLRTDGNDA
RKPSFSLQRVGSTSQLRFAGLPLGHEFTSLVLALLWTGGHPPKAEQDVLDQIDALEGDFN
FEVYMSLSCHNCPDVVQALSLMAIRNPRIKTTVIEGGAFQEEVNRREVMAVPMVFLNGEV
FGSGRMLLEEIVAKLDTGAAAKEAAKLSAKEAFDVLIIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLGIENYISVLETDGPKFAAALEAHTRAYDVDIMNLQRAEALIPATEPG
GLIEVKLANGGSLRSKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGVVQHVTLVEFADQLKADAVLVSKLKSLPNVTIHTNAQTTEITGA
DGKVNGMKFKDRASGQEHLVPLEGVFVQIGLVPNTDWLKGTVELSRFGEVEIDAKGHTNV
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRSGVTA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaacaactcaagacccaactttcggcatacctggaacgcgtgcagcagccg
ttcgagctggtggcatccctggacgacagcgacaccgcccgcgaaatgctggacctgttg
caaaccatccagtcgctgcgcagcgacaagatcaccctgcgcaccgatggcaacgacgcg
cgcaagccctcgttctcgctacagcgcgtgggtagcaccagccagctgcgctttgccggc
ctgccgctgggccatgagttcacgtcgctggtgctggcactgctctggacgggcggccat
ccgcccaaggccgaacaggacgttctggaccagatcgacgcgctcgaaggcgatttcaac
ttcgaggtctacatgagcctgagctgccacaactgccccgacgtggtgcaggcgctgagc
ctcatggccatccgcaacccgcgcatcaagaccacggtgatcgaaggcggcgccttccag
gaagaagtcaaccgccgcgaagtcatggccgtgcccatggtgttcctgaacggcgaagtg
ttcggctcgggccgcatgctgctcgaagaaatcgtcgccaagctcgataccggcgccgcc
gccaaagaggccgccaagctcagcgccaaggaagcctttgacgtgctcatcatcggtggt
ggccccgcaggcgccgcggccgctgtgtatgccgcccgcaagggcatccgcaccggcgtg
gccgccgaacgctttggcggacaggtcaatgacaccctgggcatcgaaaactacatctcg
gtgctggagaccgacggccccaagtttgccgccgccctcgaagcccacacccgcgcctac
gacgtagacatcatgaacctgcagcgcgctgaagcgctgattcccgccaccgaacccggc
ggcctgatcgaggtgaagctggccaacggcggctcgctcaggtccaagaccgtgatcctc
tccaccggcgcgcgctggcgcaatgtcaacgtgcccggcgaagccgaatacaagaacaag
ggcgtggcctattgcccccattgcgatggcccgctgttcaagggcaagcgcacagcggtc
atcggtggcggcaactcgggtgtcgaggccgctattgacctggccggtgtggtgcagcac
gtcacgctggtggagtttgccgaccagctcaaggccgacgccgtgctggtgagcaagctc
aagagcctgcccaatgtcaccatccataccaacgcgcagaccaccgaaatcaccggtgcc
gacggcaaggtgaacggcatgaagttcaaggaccgcgcctcgggccaggagcacctggtg
cccctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgactggctcaagggc
acggtcgagttgagcaggtttggcgaggtcgagatcgacgccaagggccacaccaacgtg
cccggcgtgtttgctgccggcgactgcaccaccgtgccctacaagcagatcgtgattgcc
gccggagccggcgccacggccgcgctgagcgcgttcgaccatttgattcgcagcggcgta
acggcttga

DBGET integrated database retrieval system