KEGG   Acidovorax carolinensis NA2: CBP33_16940Help
Entry
CBP33_16940       CDS       T04914                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00564  Glycerophospholipid metabolism
acid01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBP33_16940
Enzymes [BR:acid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CBP33_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like NAD_binding_8 3HCDH_N GIDA Lycopene_cycl Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ART50266
UniProt: A0A240TXF2
LinkDB All DBs
Position
complement(3598320..3599912)
Genome map
AA seq 530 aa AA seqDB search
MTHAADPLPTRRADLLARLAQPHQYDLAVIGGGATGLGVALDAAARGFSVVLVDSHDFAK
GTSSRSTKLVHGGVRYLAQGSIALVREALHERTTLLHNAPHLAQPLPFVMPSYRFWETPF
YGIGLKMYDALAGKAGLGATEFMGRARTLACLPTARAEGLKGGVKYWDGQFDDARLALAL
ARTAASLGALVVNYCPARSLIHEGGKVAGFVCEDTDSGQQFTVRAHAVVNATGVWVDTLR
QLDGEAIDRPVKPIVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKLILGT
TDSPRQDIVREPEPFQEEVRFILEESARYLTRAPQVEDIRSIWVGLRPLVKPQDDDGDNT
KKISREHTVLASRSGLITVTGGKWTTYRAMAEDVLQKCFATGLLLEKPAGLTNHLPLVGA
PREAVRHRISDDQGLHSYGSEASLVGAIGGAQTHLGGGLTEGMVRFAARYEYACTVEDVL
ARRSRLLFLDARKAIELAPVVADILRQELGADPHLEAFLALAQQYLHIPR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgccgcagaccctcttcctacgcgacgcgccgacctgctggcccgcctggcc
cagccgcaccaatatgaccttgctgtgattggcggcggggcgacggggttgggggttgcg
ctggatgcggcagcgcgtggtttcagcgtggttcttgtcgactcgcacgacttcgccaaa
gggacttcgtcgcgctccacgaagctggtgcacggcggtgtccgttatctggcgcaggga
agcatcgcgctggtgcgcgaagcgctgcatgagcgcacgaccctcttgcacaacgcaccc
catctcgcgcaacccttgccgttcgtgatgccctcgtaccggttctgggagacgccgttt
tacggcatcggcctcaagatgtacgacgctttagcgggcaaggccggtttgggcgctacc
gaattcatggggcgtgcgcgcacgctggcatgcctgcccacggcccgcgccgaggggctc
aaggggggcgtcaaatactgggacggacagttcgacgatgcccgcctggccttggccttg
gcgcggacggcagccagcctgggggccttggtggtcaattactgcccggcgcgttcgctg
attcatgagggcggcaaggtggcaggcttcgtgtgtgaagacaccgacagtggccagcag
ttcaccgtgcgcgcacacgctgtcgtgaatgccacaggcgtttgggtggacacgctgcgc
cagctggacggcgaggccatcgatcgcccggtcaagcccatcgtcgcacccagccaaggt
gtgcatattgttgtggaccgggagtttctaccgtcggatcacgccctgatggtgcccaag
acggccgatggccgggtcctttttgcggtgccgtggctgggcaagctgattctgggaacg
acagacagcccgcgccaggacatcgtccgtgagccggagccgttccaggaagaagtccgg
ttcatcctggaagaatcggcgcgctacctcacccgtgcgccccaggtggaggacatccgg
agtatctgggtgggcctgcggccactggtgaagccgcaggacgacgatggcgacaacacc
aagaagatcagccgggagcacaccgtgttggccagccgcagcggcctgattaccgtgacg
ggcgggaaatggaccacttaccgtgccatggcggaggatgtgttgcaaaaatgcttcgcc
accggcctgctcctggaaaaaccggcaggcctgaccaaccatctgcccttggtgggagcg
ccccgggaagccgttcggcatcgcatcagtgatgaccaagggctccattcatatggcagc
gaggcgtcgcttgtcggggctatcggcggggcgcagacccatcttggtggcgggctgaca
gagggaatggtgcgttttgcggcgcgctacgaatacgcctgtacggtggaggatgtgctg
gcccgccgctcaagattgctgtttctggacgctcgcaaggccatagagctggcgcctgtt
gttgcggacatcctgcgccaagagttgggcgctgatccgcatctggaggcctttctggcg
ttggcgcaacagtatttgcacattcctcgctaa

DBGET integrated database retrieval system