KEGG   Acidiferrobacter sp. SPIII_3: C4901_07270Help
Entry
C4901_07270       CDS       T05469                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00500  Starch and sucrose metabolism
acii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C4901_07270
Enzymes [BR:acii01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     C4901_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AWP23151
UniProt: A0A2Z3QZ27
LinkDB All DBs
Position
complement(1458850..1461231)
Genome map
AA seq 793 aa AA seqDB search
MSTIRAPVALWRRPVWSTGRKDCVGTALGHSRLWFTIGHGIVTEVFYPRIDIPQIRDLGF
LIADGRGFWQEIKALPDPILELEDARVPLPRLRHRHERFEFTLQVCADPDRDVLLIDFAL
AGNADLRPYLLCAPRLGEDARANRAWVGSWEGRRVLWAEQGPFGLAIHCRDADGYAVLGA
CAVGEVGASDLWQDFHLNGRMTWGYTEAGPGEVALGGALPPRGTLALGLGSSKEAAATSA
WSSLAEGFPRAAQEYTAHWRAWHAARIYPQDIATRLPSDIAALYTRSATVIKVHEDHTFP
GALVASLSVPWGETSDTLGGYHLVWSRDLVESAGALLALGAHKEPCQILAYLIGTQQADG
HWLQNQWLGGKPFWNGVQLDEAGFPVLLASALKAHGALGDMAVTDMVFRALSFIVCEGPV
TAQDRWEEDAGINAFTLAVMIAALVEGATFLDGRARACALMFADYWNARIEAWTYAEGDP
LSPYAEGDPLSRQFQVPGHYIRMAPPDILTDHDADREVLPIKNRADDPQLAACCQVSNDF
LQLVRYGLRDARDPRILASVTVMDGLLKTDTPSGPVWHRYNGDGYGEHADGRPFDGTGIG
RGWPLLTGERGHYAIAAGDDALPYLRAMAAMTGQGGLLPEQVWDSAPIPEYDLIAGRPSG
SAMPLVWAHGEFVKLCHSHMLGVPVDRPVATWERYRGVRPTPDFCIWQLHQRPHHLRAGE
ELRIALAAPFTVHWGQDGWQTVRDTPSEDWGLLHVAILPREALRAASTVQFTLRWQTGDW
VGQDFHIDVRRDP
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccatacgagcccctgtcgcgctctggcgccgcccggtgtggtccacgggtcgc
aaggactgcgtgggtacggcgcttggtcacagccggctctggtttaccatcggccatggc
attgtcaccgaggtcttttacccgcgtatcgatatcccgcagattcgcgatctcgggttc
ctgatcgcagacgggcgcggcttctggcaggagatcaaggcgctgcccgaccccatactc
gagctcgaggatgcgcgcgtccccttgccgcgcctgcgtcaccgccacgaacgcttcgag
ttcacccttcaggtctgcgccgacccagaccgcgatgttctattgatcgacttcgcgctc
gccgggaacgccgacctgcgcccctacctgctgtgcgccccgcgcctcggtgaggacgcg
cgcgccaaccgcgcgtgggtcggctcgtgggaggggcggcgcgtattgtgggccgaacaa
gggccctttggattggcgatccactgccgtgatgccgatggctatgcggtgctcggtgcc
tgcgcggtgggcgaggtcggtgcaagcgacctctggcaggactttcatctcaatgggcgc
atgacctggggatatacggaggccggacccggagaagtcgcgctcggcggcgccctgccg
ccccgtggcacgctcgccctcgggcttggcagcagcaaggaggccgccgcgaccagcgcg
tggtcctcgcttgccgagggatttccgcgcgccgcccaagaatacaccgcgcattggcgc
gcgtggcacgcggcccgcatctacccccaggacatcgccacacgactcccatccgacatc
gccgcgctctatacgcgctcggccacggtgatcaaggtccacgaggatcacaccttccca
ggcgcgttggtggcaagcctctcggtcccgtggggtgaaaccagcgacaccctgggcggc
taccacctcgtgtggtcccgcgacctggtcgagagcgcgggcgcgctcctagccctcggc
gcgcacaaggagccctgtcagatcctcgcctatctgatcggaacacagcaggccgacggc
cactggctgcaaaaccagtggctcggcggcaaacccttctggaatggcgtacaactcgat
gaggcgggctttccggtgctgctggcaagcgccctcaaggcgcacggagccttgggcgac
atggcggtcacggacatggtcttccgggcgctctccttcatcgtctgcgaaggcccggta
accgcccaggatcgctgggaggaggacgccggcatcaacgccttcacgcttgccgtgatg
atcgccgcgctggttgagggggcgacgtttctcgatggtcgcgcgcgggcgtgcgcactc
atgttcgccgactactggaatgcgcgcatcgaggcctggacctatgctgagggtgatccg
ttgtccccctatgctgagggtgatccgttgtcccggcagttccaggtccccggccactac
atccgcatggccccgcccgacatcctcaccgaccacgacgccgaccgcgaagtcctgccc
atcaaaaaccgcgctgacgacccgcagctcgccgcctgttgccaggtatccaacgatttc
ctgcaactcgtgcgctatggtctgcgcgacgcccgcgatccgcgcatcctggcctccgtg
accgtcatggacggtctattgaagaccgacacgccaagcgggccggtctggcaccgctac
aacggcgacggctatggggaacacgccgatggccggcccttcgacggcaccggcatcgga
cggggctggcccttgctcaccggcgaacgcggccattatgcgatcgctgccggcgacgac
gcgctcccctacctgcgggcgatggccgcaatgaccggacaaggaggcctgctgccggag
caggtgtgggacagcgcgccgatcccggaatacgatctcattgcgggacgtccgagcggc
tcggccatgccgctcgtatgggcacacggcgaattcgtgaagctctgccacagccatatg
ctcggcgtgccggtcgatcgcccggtggcgacctgggaacgctatcggggcgtgcgcccc
acgcccgatttttgcatctggcagctccaccagcgtccacaccacctgcgtgccggcgag
gaactgcgcattgcgctcgccgcgccgttcacggtccactggggtcaggacggctggcag
accgtgcgcgacacgccgtctgaggactgggggcttttgcatgtcgccatcctgccgcgc
gaggcgctccgcgccgccagcaccgtgcagttcaccctgcgctggcagaccggggattgg
gtgggtcaggactttcacatcgatgtcaggagggatccgtga

DBGET integrated database retrieval system