KEGG   Acidiferrobacter sp. SPIII_3: C4901_16290Help
Entry
C4901_16290       CDS       T05469                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
acii  Acidiferrobacter sp. SPIII_3
Pathway
acii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acii01100  Metabolic pathways
acii01110  Biosynthesis of secondary metabolites
acii01130  Biosynthesis of antibiotics
acii01230  Biosynthesis of amino acids
Module
acii_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C4901_16290
Enzymes [BR:acii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C4901_16290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin AAA_16 Cytidylate_kin2 ABC_tran AAA AAA_25 AAA_5 dNK TsaE CoaE AAA_22 AAA_28 AAA_29 Mg_chelatase ATP_bind_2 DUF3458_C RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AWP24689
UniProt: A0A2Z3R3H4
LinkDB All DBs
Position
complement(3219262..3219804)
Genome map
AA seq 180 aa AA seqDB search
MRVGDERIFLVGPMGAGKSTIGRCLAERLGREFCDCDQEIERRTGASVSLIFAVEGEAGF
RRWEALVLEDLVCRPNLVLATGGGAVLAPGNRALLKAHGKTVYLHADWQTLWERVRRDRH
RPLLHTEDPQARVAALMRERDPLYREVADLIVDTDRRAPHVAARLIVCGLKRVSGVDAEA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagggtaggcgacgagcggatatttctggtgggccccatgggggcggggaagtcgacc
atcgggcgctgcctggctgagcgtctggggcgggagttttgcgattgcgatcaggagatc
gaacggcggaccggggccagcgtctcgctgatcttcgccgttgagggcgaggccgggttc
cgccgctgggaggcgctggtgctggaggacctcgtctgccggccgaatctcgtcttggcc
accggcggcggcgcggtcctggccccgggcaaccgcgcgctcctgaaggcgcatggcaag
accgtctacctgcacgccgactggcagaccctgtgggagcgcgtgcgtcgcgaccggcat
cgaccgcttttgcataccgaggacccgcaggcgcgggtggcggcgctcatgcgcgagcgc
gatccgttgtatcgcgaggtcgccgacctcatcgtggataccgaccggcgagcaccgcat
gtcgccgcccggctcatcgtatgtggtctaaagagggtaagcggtgtcgacgctgaggct
tga

DBGET integrated database retrieval system