KEGG   Acidipropionibacterium virtanenii: JS278_00202Help
Entry
JS278_00202       CDS       T05538                                 

Gene name
pfkA
Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acij  Acidipropionibacterium virtanenii
Pathway
acij00010  Glycolysis / Gluconeogenesis
acij00030  Pentose phosphate pathway
acij00051  Fructose and mannose metabolism
acij00052  Galactose metabolism
acij00680  Methane metabolism
acij01100  Metabolic pathways
acij01110  Biosynthesis of secondary metabolites
acij01120  Microbial metabolism in diverse environments
acij01130  Biosynthesis of antibiotics
acij01200  Carbon metabolism
acij01230  Biosynthesis of amino acids
acij03018  RNA degradation
Module
acij_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JS278_00202 (pfkA)
   00030 Pentose phosphate pathway
    JS278_00202 (pfkA)
   00051 Fructose and mannose metabolism
    JS278_00202 (pfkA)
   00052 Galactose metabolism
    JS278_00202 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    JS278_00202 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    JS278_00202 (pfkA)
Enzymes [BR:acij01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     JS278_00202 (pfkA)
Protein phosphatases and associated proteins [BR:acij01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     JS278_00202 (pfkA)
Messenger RNA biogenesis [BR:acij03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     JS278_00202 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AXE37399
UniProt: A0A344UQ51
LinkDB All DBs
Position
complement(220739..223018)
Genome map
AA seq 759 aa AA seqDB search
MRNDDRDEQRIFDRTSRTPVLPDGRGVRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVY
AIYEGYQGMIDGGDGIRKFGWDDVGSILNRGGTVIGTFRSKEMREREGRLKAVRHLLHRG
IDRLVVIGGDGSLTGLNLLRNEWSGLVAELVERGDLAEEVAQEHPSLMIAGLVGSIDNDL
VGSDMTIGTDTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMSAVAGGADYVL
VPEQPPAPGWEEEMCAELRKGRQSGRRDSIVIIAEGATDREGRPIKAEYVRQVLADRLDE
DARVTILGHVQRGGKPSAYDRWASTWLGYNAVHEVLTATPESEGMVVGTRSNRSERLSLV
KAVADTQEVPKLIEAGRYRDAMRMRGHSFTEMDAIFSELADPVRTSPEKDYRRIGVMHAG
GPAPGMNTAMRALVRLGISRGHTMIGIHNGFVGLAAGDLAEITWSQVEGLTGEGGAMLGT
RREVPATQDLYAISRALEKNEIDALVVIGGYSAYDGVHKMTTERDRYPAFRIPTVCVPAS
IDNNLPGSELSIGADTALNVIVDAMDKIKESGIASKRCFVVETMGKNCGYLAMMSGIAAG
AERIYLNEDGISLDDLVTDVHWLRESFAKGRRLFLAVRNENASKNYTTEFLAQMMEEESH
GMYDVRTAVLGHMQQGGSPSPFDRLLATRLSYRALNLVDDELAADQDGAWFMGIRDGSTY
AGAMETMNSLVDPQHRRPRQQWWLDLRTVVRTVSDELRS
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaacgacgatcgtgacgaacagcgcatcttcgaccggaccagccggacccccgtc
ctgcccgacggccgcggcgtaaggatcggcatcctcaccagcggcggcgacgcccagggc
atgaacgccgcggtgcgggcagtggtgcgctcggcactcagcgtgggcgccgaggtctac
gccatctacgagggctaccaggggatgatcgacggcggcgacgggatccggaagttcggg
tgggacgacgtcggctcgatcctcaaccgcgggggcaccgtcatcggcaccttccgctcc
aaggagatgcgggagcgggagggacgcctcaaggccgtccgccacctgctgcaccggggc
atcgaccggctcgtcgtgatcggcggcgacgggtcgctgaccggcctgaacctgctgcgc
aacgaatggtccggactggtggccgagctcgtggagcgcggcgacctggccgaggaggtc
gcccaggagcatcccagcctcatgatcgccggactcgtcggctccatcgacaacgatctc
gtcggctccgacatgacgatcggcaccgacaccgccctgcaccggatcgtcgacgccatc
gacgatctcgcctccaccgccgccagccatcagcgatccttcgtcgtggaggtgatggga
cgccactgcggctacctggcgctgatgagtgcggtcgccggcggggccgattacgtcctg
gtccccgagcagcccccggccccgggctgggaggaggagatgtgcgccgagctgcgcaag
gggcgccagtcgggccgtcgcgactccatcgtcatcatcgccgagggcgccaccgaccgc
gagggccgtccgatcaaggccgagtacgtccgccaggtgctggccgaccggctcgacgag
gacgcccgcgtcacgatcctgggccacgtccagcgcggcggcaaacccagcgcctacgac
cgctgggcgtcgacctggctgggctacaacgccgtccacgaggtgctcaccgcgaccccc
gagtccgaggggatggtcgtgggcacccggtccaaccgctccgagcggctgtccctggtc
aaggccgtcgcagacacccaggaggtgcccaagctcatcgaggccgggcggtaccgcgac
gccatgcggatgcgcgggcactccttcaccgagatggacgccatcttctccgagctggcc
gatccggtgcgcaccagccccgagaaggactacaggcgaatcggggtgatgcacgccggc
gggccggccccgggcatgaacacggccatgcgcgccctcgtgcggctgggcatctcccgc
ggccacaccatgatcggcatccacaacggcttcgtcggcctggccgccggggacctggcc
gagatcacctggagccaggtggaagggctcaccggcgagggcggcgcgatgctcgggacc
cgccgcgaggtgccggcgacccaggacctgtacgcgatcagccgggccctggagaagaac
gagatcgacgcactggtggtgatcggcggctactccgcctatgacggcgtccacaagatg
acgacggagcgggaccgctaccccgccttccggatccccaccgtctgcgtgccggccagt
atcgacaacaacctgccgggctcggagctgtcgatcggcgccgacaccgcgctcaacgtc
atcgtcgacgcgatggacaagatcaaggagtccggcatcgcctccaagcgctgcttcgtg
gtggagacgatgggcaagaactgcggctacctcgccatgatgagcgggatcgcggccggc
gccgagcggatctacctcaacgaggacggcatcagcctggacgatctggtgaccgacgtc
cactggctgcgggagtccttcgcgaagggacgccggctgttcctggcggtgcgcaacgag
aacgcctcgaagaactacaccaccgaattcctcgcccagatgatggaggaggagtcgcac
gggatgtacgacgtacgcacggccgtgctggggcacatgcagcagggcgggtcgccgtcc
cccttcgaccggctgctcgccacccggctcagctaccgcgcgctgaacctggtggacgac
gagctggcggccgatcaggacggcgcctggttcatggggatccgcgacggaagcacctac
gcgggcgcgatggagaccatgaactccctggtcgacccgcagcaccggcgtccccgccag
cagtggtggctcgacctgcgcacggtggtccggaccgtctctgatgagttgaggagctga

DBGET integrated database retrieval system