KEGG   Acidipropionibacterium virtanenii: JS278_01256Help
Entry
JS278_01256       CDS       T05538                                 

Gene name
inhA
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
acij  Acidipropionibacterium virtanenii
Pathway
acij00061  Fatty acid biosynthesis
acij00780  Biotin metabolism
acij01100  Metabolic pathways
acij01130  Biosynthesis of antibiotics
acij01212  Fatty acid metabolism
Module
acij_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acij00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JS278_01256 (inhA)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JS278_01256 (inhA)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JS278_01256 (inhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acij01004]
    JS278_01256 (inhA)
Enzymes [BR:acij01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     JS278_01256 (inhA)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     JS278_01256 (inhA)
Lipid biosynthesis proteins [BR:acij01004]
 Fatty acid synthase
  Component type
   JS278_01256 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short TusA
Motif
Other DBs
NCBI-ProteinID: AXE38432
UniProt: A0A344UT34
LinkDB All DBs
Position
1376213..1376986
Genome map
AA seq 257 aa AA seqDB search
MGLLDGKTILVTGVTMHTSIAFKVAEIAQQQGARVIVSNIPRAIRVTQRAVRKLDPVPEV
IELDATDDQALAALPATLRGLGVERLDGVVHAIAFANPKTALGGEFLNTEWKDVDVALHT
STYSYVSLAKAVQPLFGDTAAVVGLTFDATVSWPFYDWMGVAKSGLESANRYLARYLGKD
QVRCNLVSAGPLDTMAKTSIPGADAFNDLWGERAPLGWDTKDAGAAAKGIVALLSDWFPA
TTGEMIHVDGGLHSTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggacttctcgacggtaagaccatcctcgtcaccggcgtgacgatgcacacctcgatc
gccttcaaggtggccgagatcgcccagcagcagggcgcccgcgtcatcgtctccaacatc
ccccgcgccatccgcgtcactcagcgggcggtgcgcaagctcgacccggttcccgaggtc
atcgagctcgacgccaccgacgaccaggccctggccgccctgcccgccacactgcgcgga
ctgggcgtcgagcggctcgacggggtcgtccacgccatcgccttcgccaacccgaagact
gcgctgggcggtgagttcctcaacaccgagtggaaggacgtcgacgtcgccctccacacc
tccacctactcctacgtgtccctggcgaaggccgtccagccgctcttcggcgacacggcc
gcggtcgtaggcctcaccttcgacgccaccgtctcatggcccttctacgactggatgggt
gtcgcgaagtccggtctcgaatcggccaaccggtacctggcccgctacctgggcaaagac
caggtgcgctgcaacctcgtctccgccggccccctggacaccatggccaagacctccatc
cccggtgccgacgccttcaacgacctgtggggggagcgggccccgctcggctgggacacc
aaggacgccggcgccgccgcgaagggcatcgtcgcgctgctgtcggactggttcccggcc
accaccggcgagatgatccacgtcgacggcgggcttcactccaccggcgcctga

DBGET integrated database retrieval system