KEGG   Acidovorax carolinensis NA3: CBP34_00950Help
Entry
CBP34_00950       CDS       T04997                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP34_00950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acin02000]
    CBP34_00950
Enzymes [BR:acin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBP34_00950
Transporters [BR:acin02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBP34_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_C GST_C_2 GST_N_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ART50513
UniProt: A0A240TZD6
LinkDB All DBs
Position
1:complement(204425..205036)
Genome map
AA seq 203 aa AA seqDB search
MSAPTLYLAPGTCALAVHIALHEAQAGHELVRLDFAAQQQRSPEYLAINPKGRVPALVTE
HGVLTETPALLAYVAQRYAQGQLAPLDPFAFARMQEFNSYLASTVHVAHAHGRRGSRWAD
DPASHADMLRKVPQNMAECFGVIEHHYLQGPWVLGEQYSVADAYLFTMSGWLRSDGVDVA
QFPKVADHRRRMAERPAVQRALA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccacgctgtacctcgcccccggcacctgcgccctggccgttcacattgcc
ttgcacgaggcccaggcaggccacgaactggtgcgccttgactttgccgcccagcagcaa
cgcagccccgaatacctggccatcaaccccaaaggccgcgtgcctgccttggtgaccgag
cacggcgtgctgaccgaaaccccggcactgctggcctatgtggcccagcgctatgcccag
gggcagctggcgccactggatccgtttgccttcgcacgcatgcaggagttcaacagctac
ctggcctccaccgtgcatgtggcccacgcccacgggcggcgcggcagccgctgggcagac
gatcccgcctcccatgccgacatgctgcgcaaagtcccgcagaacatggcggagtgcttt
ggcgtgatcgaacaccactacctgcaaggcccttgggtgctgggggagcaatattccgtt
gccgatgcctacctgttcaccatgtccggctggctgcgcagcgatggtgtggacgtggcg
cagttccccaaggtggccgaccaccggcgccgcatggccgagcggcctgccgtccagcgc
gcgctggcctga

DBGET integrated database retrieval system