KEGG   Acidovorax carolinensis NA3: CBP34_01770Help
Entry
CBP34_01770       CDS       T04997                                 

Definition
(GenBank) MFS transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CBP34_01770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acin02000]
    CBP34_01770
Transporters [BR:acin02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    CBP34_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 P3A
Motif
Other DBs
NCBI-ProteinID: ART50641
UniProt: A0A240U8I4
LinkDB All DBs
Position
1:359469..360761
Genome map
AA seq 430 aa AA seqDB search
MANAPLSVGDSPQRSRQAWSVLLVSTLAFTVCFMVWMMFGVIGIPIKKMLNLSSTQFGLL
TAMPVLTGSLVRVPLGIWTDRFGGRIVMTVLMALTVPAIWLMSYATEYWHFLTIGLFVGL
AGGSFSVGTPYVARWFPKNRQGMAMGVYGAGNSGAAVNKFVAPVLLVAFGWAMVPQVYAA
IMLGTLVLFWLFSYSDPAHLVPSNVKFTDQLRALKDPKVIKYCQYYSIVFGGYVALSLWM
VQYYVGEYGLDIRVAALLAACFSLPGGVLRAIGGVLSDKYGAHSVTWWVMWVSWICLFLL
SYPQTDFTILTVDGPTTFHIGLNVYAFTALMGVLGVAFAFGKASVFKYISDDYPKNIGAI
SGIVGLAGGLGGFVLPIMFGALMDFTGIRSSAFMLMYGVVWVSLIWMYFTEVRRTDVMDP
TGASPAGAAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgcaccgctttcggtaggcgacagtccgcaacgcagccggcaggcttggtcg
gtgctcttggtgagcacgctcgccttcaccgtctgtttcatggtgtggatgatgttcggg
gtgatcggcattccgatcaagaaaatgctgaacctgagctccacgcaattcggcttgctc
acggccatgccggtgctcaccggctcgctggtgcgtgtgccgctgggcatctggaccgac
cgattcggcgggcggatcgtcatgacggtgctaatggcgctgaccgtgcccgcaatctgg
ctcatgagctatgccaccgagtactggcacttcctcacgatcggcctgtttgtcgggctg
gcgggtggctcgttctcggtgggcacgccctatgtggcgcgctggtttcccaagaaccgc
cagggcatggcgatgggcgtttatggtgcgggcaattcgggggcggcggtgaacaagttt
gtcgcgccggtgctgctggtggcctttggctgggccatggtgccgcaggtgtatgccgcc
atcatgctcggcaccctggtgctgttctggctcttcagctacagcgacccggcccatctg
gtgcccagcaatgtcaagttcaccgaccagctcagggcgctcaaggaccccaaggtcatc
aagtattgccagtactacagcatcgtattcggtggctatgtggcgctgtcgctgtggatg
gtgcagtactacgtgggcgagtacggcctggacatccgcgtggcggcgctgctggcggcc
tgcttctccctgccgggcggcgtgctgcgcgccattggcggtgtgctcagtgacaagtat
ggcgcccacagcgtgacctggtgggtgatgtgggtgagctggatctgcctgttcctgctg
agctacccgcagaccgatttcaccatcctcacggtcgatgggcccaccacgttccacatc
ggtttgaacgtctatgccttcaccgcgctgatgggggtgctgggcgtggcgttcgccttc
ggcaaggccagtgtcttcaagtacatcagtgatgactatccgaagaacattggcgccatc
agcggcattgtcggcctggctggcggtttggggggctttgtgctgcccatcatgtttggc
gccctgatggacttcaccggcattcgttccagcgccttcatgctgatgtatggcgtggtc
tgggtatcgctgatctggatgtatttcaccgaagtccgtcgcaccgatgtgatggacccg
accggggcttcgccggccggtgcagcccgctga

DBGET integrated database retrieval system