KEGG   Acidovorax carolinensis NA3: CBP34_13510Help
Entry
CBP34_13510       CDS       T04997                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
acin  Acidovorax carolinensis NA3
Brite
KEGG Orthology (KO) [BR:acin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBP34_13510
Enzymes [BR:acin01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBP34_13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin FAD_binding_3 DAO K_oxygenase FMO-like AlaDh_PNT_C Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ART52462
UniProt: A0A240U3R9
LinkDB All DBs
Position
1:complement(2900566..2902134)
Genome map
AA seq 522 aa AA seqDB search
MLDEQLKTQLSAYLERVQQPFELVASLDDSDTAREMLDLLQTIQSLRSDKITLRTDGNDA
RKPSFTLQRVGSTSQLRFAGLPLGHEFTSLVLALLWTGGHPPKAEQDVLDQIDALEGDFN
FEVYMSLSCHNCPDVVQALSLMAIRNPRIKTTVIEGGAFQEEVNRREVMAVPMVFLNGEV
FGSGRMLLEEIVAKLDTGAAAKEAAKLSAKEAFDVLIIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLGIENYISVLETDGPKFAAALEAHTRAYDVDIMNLQRAEALIPATEPG
GLIEVKLGNGGSLRSKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGVEAAIDLAGVVQHVTLVEFADQLKADAVLVSKLKSLPNVTIHTNAQTTEITGA
DGKVNGMKFKDRATNEEHLVPLEGVFVQIGLVPNTDWLKGTVELSRFGEIEIDAKGHTNV
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRSGVTA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaacaactcaagacccaactttcggcatacctggaacgcgtgcagcagccg
ttcgagctggtggcatccctggacgacagcgacaccgcccgcgaaatgctggacctgttg
caaaccatccagtcgctgcgcagcgacaagatcaccctgcgcaccgatggcaacgacgcg
cgcaagccctcgttcacgctgcagcgcgtgggcagtaccagccagctgcgctttgccggc
ctgccgctgggccatgagttcacatcgctggtgctggcactgctctggacgggcggccat
ccgcccaaggccgaacaggacgttctggaccagatcgacgcgctcgaaggcgatttcaac
ttcgaggtctacatgagcctgagctgccacaactgccccgacgtggtgcaggcgctgagc
ctcatggccatccgcaacccgcgcatcaagaccacggtgatcgaaggcggcgccttccag
gaagaagtcaaccgccgcgaagtcatggccgtgcccatggtgttcctgaacggcgaagtg
ttcggctcgggccgcatgctgctcgaagaaatcgtcgccaagctcgacaccggcgcggcc
gcgaaagaggccgccaagctcagcgccaaagaagcctttgacgtactcatcatcggcggt
ggccccgcaggcgctgcagccgccgtgtacgccgcccgcaaaggcatccgcaccggcgtg
gccgccgaacgctttggtggccaggtgaatgacacactgggcatcgaaaactacatctcg
gtgctggagaccgacggccccaagtttgccgccgccctcgaagcccacacccgcgcctac
gacgtagacatcatgaacctgcagcgcgctgaagcgctgattcccgccaccgaacccggc
ggcctgatcgaggtgaagctgggcaacggcggctcgctcaggtccaagaccgtgatcctc
tccaccggcgcgcgctggcgcaatgtgaatgtgcccggcgaagccgagtacaagaacaaa
ggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtcggtc
atcggcggcggcaactcgggtgtcgaggccgctattgacctggccggtgtggtgcagcat
gtcacgctggtggagtttgccgaccagctcaaggccgacgccgtgctggtgagcaagctc
aagagcctgcccaatgtcaccatccataccaacgcgcagaccaccgaaatcaccggtgcc
gacggcaaggtgaacggcatgaagttcaaggaccgcgccacgaacgaagagcacctggtg
cccctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgactggctcaagggc
acggtcgagttgagcaggtttggcgagatcgagatcgacgccaagggccacaccaacgtg
cccggcgtgtttgctgccggcgactgcaccaccgtgccctacaagcagatcgtgattgcc
gccggcgccggtgccacggccgcgctgagcgcgttcgaccatttgatccgcagcggcgta
acggcttga

DBGET integrated database retrieval system