KEGG   Acidovorax carolinensis NA3: CBP34_15665Help
Entry
CBP34_15665       CDS       T04997                                 

Definition
(GenBank) sodium:solute symporter
Organism
acin  Acidovorax carolinensis NA3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-ProteinID: ART52810
UniProt: A0A240U606
LinkDB All DBs
Position
1:complement(3349111..3350556)
Genome map
AA seq 481 aa AA seqDB search
MLLTLVIVYLLITIAIGLVAAKRVKNAADFAIAGRHLPLYMIVTTTFATWFGSETVLGIP
AKFIEGGLGNVVEDPFGAGFCLILVGLFFAGKLYRMTLLTISDYYRERYGRVVEVVCSLI
IMLSYLGWVSAQVTALGLVFNLLSGGAISIPVGMTIGVVSILAYTLFGGMWSVAVTDFIQ
MIILVVGLTLIAVFAGNMAGGAGKVIELASSRELFRFLPEPKFHDIVFFIAAGITMMFGS
IPQQDVFQRVMSANNIQAATRGPVIGGIFYILFAFVPMFLVASALIIMPTETAALLKDDP
QKVLPTLVLEKMPFVMQVLFFGALLSALKSTASATLLAPSVTFTENIWRQFRPHASDRQH
LRTMRITTLVFSGLVLAYAIRMEGTSIYELVSGAYQVPLVGAFVPLVFGLYWKRASTQGA
VFAIVLGLLTWVLFLATPAGQVFPAQLAGLLAALVGMLAGSLGPQAIRNSHAGHHRLVGV
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgaccctggttatcgtctatctgttgatcaccatcgccattggcctggttgcc
gccaagcgggtcaagaatgccgccgatttcgcaattgccgggcggcacctgccgctgtac
atgatcgtcaccaccaccttcgccacctggtttggttcggagacggtgctggggattccg
gccaagttcattgagggcgggctgggcaatgtggtcgaagacccgttcggcgcggggttc
tgcctgattctggtgggcctgttctttgcgggcaagctttaccgcatgacgttgctgacc
atcagcgactactaccgcgagcgctatggccgcgtcgtcgaggtcgtgtgctcgctgatc
atcatgctgagctatctgggctgggtgtcggcccaggtcaccgccttgggactggtgttc
aacctgctgtccggcggggccatcagcattcccgtgggcatgacgatcggggtggtttcc
atcctggcgtacacgttgtttggcggcatgtggtcggtggccgtgacggacttcatccag
atgatcatcctggtggtggggctgacattgatcgccgtgtttgcgggcaatatggccggt
ggggcaggcaaggtcatcgaactggcctccagccgcgagttgttccgctttctgccggag
cccaaattccacgacatcgtgttcttcattgcggccggcatcacgatgatgtttggctcg
attccccagcaggatgtctttcagcgcgtcatgtcggccaacaacattcaggccgccacg
cgcgggccggtgattggtggcatcttctacatcctgtttgcctttgtgcccatgtttctg
gtggcgagcgcgctcatcatcatgccgacggaaacggcggcgctgctcaaggacgatccg
caaaaggtgctgcccacgctggtgctggagaagatgccgtttgtcatgcaggtgctcttt
tttggtgcgttgctgtcggcactcaagtccacggcctcggccaccttgctggcgcccagc
gtgacgtttaccgagaacatctggcggcagttccgtccgcatgcctcggaccggcagcat
ttgcgcaccatgcgcatcaccacgctggtattcagcggcctggtgctggcctatgcgatt
cgcatggaaggcacctccatctatgaactggtctcgggcgcctaccaggtgccattggtc
ggcgcttttgtgccgctggtgtttggcctgtactggaagcgggcctccacccagggggcg
gtttttgccatcgtgctggggctgttgacctgggtgctgtttctggcaaccccggcgggc
caggtgtttccggcgcaactggccggcttgctggcagcgctggtgggtatgctggcggga
tcgctgggcccccaggccattcgcaacagccatgccgggcaccatcggctggtgggcgtg
gaatga

DBGET integrated database retrieval system