KEGG   Acidovorax carolinensis NA3: CBP34_17540Help
Entry
CBP34_17540       CDS       T04997                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acin  Acidovorax carolinensis NA3
Pathway
acin00564  Glycerophospholipid metabolism
acin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBP34_17540
Enzymes [BR:acin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CBP34_17540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like NAD_binding_8 Lycopene_cycl 3HCDH_N GIDA Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ART53771
UniProt: A0A240U8Q0
LinkDB All DBs
Position
1:complement(3729213..3730805)
Genome map
AA seq 530 aa AA seqDB search
MTHAADPLPTRRADLLARLAQPHQYDLAVIGGGATGLGVALDAAARGFSVVLVDSHDFAK
GTSSRSTKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLPFVMPSYRFWETPF
YGIGLKMYDALAGKAGLGATEFMGRARTLACLPTARAEGLKGGVKYWDGQFDDARLALAL
ARTAASLGALVVNYCPARSLIHEGGKVAGFVCEDTDSGQQFTVRARAVVNATGVWVDTLR
QLDGEAIDRPVKPIVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKLILGT
TDSPRQDIVREPEPFQEEVRFILEESARYLTRAPQVEDIRSIWVGLRPLVKPQDDDGDNT
KKISREHTVLASRSGLITVTGGKWTTYRAMAEDVLQKCFATGLLMEKPAGLTNHLPLVGA
PREAVRHRISDAQGLHSYGSEASLVGAIVGAQTHLDGGLTEGMVRFAARYEYACKVEDVL
ARRSRLLFLDARKAIELAPVVADILRQELGADPHLEAFLALAQQYLHIPR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgccgcagaccctcttcctacgcgacgcgccgacctgctggcccgcctggcc
cagccgcaccaatatgaccttgctgtgattggcggcggggcgacggggttgggggttgcg
ctggatgcggcagcgcgtggtttcagcgtggttcttgtcgactcgcacgacttcgccaaa
gggacttcgtcgcgctccacgaagctggtgcacggcggtgtccgttatctggcgcaggga
aacatcgcgctggtgcgcgaagcgctgcatgagcgcacgaccctcttgcacaacgcaccc
catctggcgcaacccttgccgttcgtgatgccctcgtaccggttctgggagacgccgttt
tacggcatcggactcaagatgtacgacgctttagcgggcaaggccggtttgggcgctacc
gaattcatgggacgtgcgcgcacgctggcatgcctgcccacggcccgcgccgaggggctc
aagggtggcgtcaaatactgggacggacaattcgacgatgcccgtctggccttggccttg
gcacggacggcagccagcctgggcgccttggtggtcaattactgcccggcgcgttcgctg
attcatgagggcggcaaggtggcaggcttcgtgtgtgaagacaccgacagtggccagcag
ttcaccgtgcgcgcacgcgctgtcgtgaatgccacaggcgtttgggtggacacgctgcgc
cagctggacggcgaggccatcgatcgcccggtcaagcccatcgtcgcacccagccaaggt
gtgcatattgttgtggaccgggagtttctaccgtcggatcacgccctgatggtgcccaag
acggccgatggtcgggtgctttttgcggtgccgtggctcggcaagctgattctgggaacg
acagacagcccgcgccaggacatcgtgcgtgagccggagccgttccaggaagaagtccgg
ttcatcctggaagaatcggcgcgctacctcacccgtgcgccccaggtggaggacatccgg
agtatctgggtgggcctgcggccactggtgaaaccgcaggacgacgatggcgacaatact
aagaagatcagccgggagcacaccgtgttggccagccgcagcggcctgattaccgtgacg
ggcgggaaatggaccacttaccgtgccatggcggaggatgtgttgcaaaaatgcttcgcc
accggcctgctcatggaaaaaccggcaggcctgaccaaccatctgcccttggtgggagcg
ccccgggaagccgttcggcatcgcatcagtgatgcccaagggctccattcatatggcagc
gaggcgtcgcttgtcggggctatcgtcggggcgcagacccatcttgatggcgggctgaca
gagggaatggtgcgttttgcggcgcgctacgaatacgcctgtaaggtggaggatgtgctg
gcccgccgctcaagattgctgtttctggacgctcgcaaggccatagagctggcgcctgtt
gttgcggacatcctgcgccaagagttgggcgctgatccgcatctggaggcctttctggcg
ttggcgcaacagtatttgcacattcctcgctaa

DBGET integrated database retrieval system