KEGG   Acidovorax sp. 1608163: EAG14_02095Help
Entry
EAG14_02095       CDS       T05680                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acio  Acidovorax sp. 1608163
Pathway
acio00564  Glycerophospholipid metabolism
acio01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acio00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAG14_02095
Enzymes [BR:acio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EAG14_02095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N Lycopene_cycl GIDA FAD_binding_3 Pyr_redox Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AYM95095
UniProt: A0A3G2FRN6
LinkDB All DBs
Position
477599..479191
Genome map
AA seq 530 aa AA seqDB search
MTNVSAPLPTPRAELLDRLAQPHLYDLAVIGGGATGLGVALDAAARGFSVVLVDSHDFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLSNAPHLAQPLPFVMPSYRFWETPF
YGIGLMMYDALAGKAGLGATQFLGRERTLQCLPTARKDGLKGGVKYWDGQFDDARLALAL
ARTAASRGALLVNYCPAKKLVHEGGRVAGFECEDVESGRAFTVKARCVVNATGVWVDGLR
QMDGEAIGKPVKPIVAPSQGVHIVVDKEFLPSDHALMVPKTADGRVLFAVPWLGKLILGT
TDSPRQDVVREPLPFKEEVAFILNESARYLTRAPKPEDIRSIWVGLRPLVKPQDDDGGNT
KSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLQKCFDTGALPPKAAGVTNQLPLVGT
PTEAVRHRISDAPGMHSYGADAAQVAGLPGASNALGGGLTEAMVRFAARFEYARTVEDVL
ARRSRMLFLDARLAQEVAPAVAEILREELGGDPQLPAFLALAPQYLRPEM
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtttcagccccccttcccaccccgcgtgccgaacttctggaccgtttggcc
cagccgcacttgtatgacctggccgtgattggcgggggcgccacgggcctgggggtggcc
ttggatgcggcggcgcggggtttcagtgtggtgctggtggattcgcacgatttcgccaag
ggcacctcatcccgggccaccaagctggtgcacggtggcgtgcgctacctggcgcagggc
aatatctccctggtgcgcgaggccctgcacgagcgcaccacgctgctgagcaacgcgccc
cacctggcgcagcccctgccgtttgtgatgccgtcctaccgcttttgggagacgcccttc
tacggcatcggcctcatgatgtacgacgccctggcgggcaaggccgggctgggtgccacg
cagttcctggggcgcgagcgcaccttgcagtgcctgcccacggcccgcaaagacgggctc
aaaggcggcgtgaagtattgggatggccaatttgacgacgctcgtctggccctggcgctg
gcgcgcaccgctgccagccgcggagcgctgctggtgaactactgccccgccaagaagttg
gtccatgaaggtgggcgggtggctgggttcgagtgtgaagacgtggaatctggccgtgct
ttcacggtcaaggcgcgctgcgtggtgaatgccacgggtgtgtgggtggatggcctgcgc
caaatggacggggaggccattggcaagcccgtcaagcccatcgtggcgcccagccagggc
gttcacatcgtggtggacaaagaatttttgccgtcagaccatgcactgatggtgcccaag
acggcggacgggcgggtgctttttgcggttccgtggctgggcaagctcattttgggcacc
acagacagcccccgccaggatgtggtgcgcgagcctttgccgttcaaggaagaagtcgcc
ttcatcctgaacgagtctgcccgctacctgacccgcgcgcccaagcccgaggacattcgc
agcatctgggtcgggttgcgccccttggtcaagccgcaggacgatgacggcggtaacacc
aagagcattagtcgggagcacaccgtgctggccagccgcagtggcctggtcaccgtgacg
ggcggcaagtggacgacctatcgcgccatggccgaagacgtgctgcaaaagtgctttgat
actggagctttgccgcccaaggctgcgggtgtgaccaaccagctgccgctggtgggtacc
ccgaccgaggcggtgcgccaccgtatcagcgacgcgccaggcatgcattcttatggggca
gatgctgcgcaagtggcgggtttaccaggggcatccaacgccttgggcggtggattgacc
gaggcgatggtgcggtttgctgcacgctttgaatacgcccgaaccgtcgaggacgtgctg
gcgcgccgctcgcgcatgctgttcctggacgcccgcctggcccaggaggttgcccctgcc
gttgcagagatcctgcgagaagagttgggtggcgacccgcagttgcctgcttttttggca
ttggcaccacaatatttgcgcccagaaatgtga

DBGET integrated database retrieval system