KEGG   Acidovorax sp. 1608163: EAG14_18830Help
Entry
EAG14_18830       CDS       T05680                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
acio  Acidovorax sp. 1608163
Pathway
acio00061  Fatty acid biosynthesis
acio01100  Metabolic pathways
acio01212  Fatty acid metabolism
Module
acio_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:acio00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EAG14_18830 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:acio01004]
    EAG14_18830 (fabA)
Enzymes [BR:acio01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EAG14_18830 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     EAG14_18830 (fabA)
Lipid biosynthesis proteins [BR:acio01004]
 Fatty acid synthase
  Component type
   EAG14_18830 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AYM97783
UniProt: A0A3G2FZX9
LinkDB All DBs
Position
complement(4241280..4241801)
Genome map
AA seq 173 aa AA seqDB search
MADSFSYEQLIASGEGRLFGADSGRLPLPPMLMFDRITHIDSDGGAHGLGKIRAELDVKP
DLWFFACHFQGDPVMPGCLGLDAMWQLIGFYLTWLQLPGRGRALGAGEVKFTGEVGPDVK
LVTYEIDIKRVIKRKLVMAIGDARLLADGKEIYVANDLRVGLFKREEEGKDAA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagattccttttcctacgaacaactgatcgcctcgggcgagggccggctgttcggc
gctgacagcgggcgcctgccgctgccacccatgctgatgtttgatcgcatcacgcacatc
gacagcgatgggggcgcgcacggtttgggaaagatccgcgcggaactggacgtcaagccc
gacctgtggtttttcgcctgccactttcagggtgaccctgtcatgcccggctgcctgggc
ctggatgccatgtggcaactcatcggtttttacctgacctggctgcaactgcccggccgt
ggccgcgcattgggtgcgggcgaggtcaagttcaccggcgaagtgggcccagacgtgaag
ctggtcacctacgaaatcgacatcaagcgcgtcatcaagcgcaagctggtcatggccatt
ggcgatgcccgtttgctggccgatggcaaggaaatttatgtagccaacgacctgcgtgtg
ggcttgttcaagcgcgaggaagaaggcaaggacgcagcatga

DBGET integrated database retrieval system