KEGG   Acidovorax sp. 1608163: EAG14_21910Help
Entry
EAG14_21910       CDS       T05680                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acio  Acidovorax sp. 1608163
Pathway
acio00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acio00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAG14_21910 (gstA)
Enzymes [BR:acio01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EAG14_21910 (gstA)
Transporters [BR:acio02000]
 Other Transporters
  Pores ion channels [TC:1]
   EAG14_21910 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 PQQ_3
Motif
Other DBs
NCBI-ProteinID: AYM98285
UniProt: A0A3G2G0J7
LinkDB All DBs
Position
4893206..4893811
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIALHEAGLAFDAVLASTKTHKLQDGTDFYTINELGYVPVLELDNG
ERLREGPAIVQYVADQVPSKGLAPAHGTMERYRLQEWLTFIGTELHKGHSPLFAPNTPEE
YKPIVRERLQSRFAWVDKQLAGKDYLLGSFSVADGYLYTVSRWGQFVGVDTSGLANLQAF
KQRMEARPGVQAALKAEGLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtactactcccccggcgcctgctcgctgtcgccccacatcgctttgcacgaa
gcgggcttggcgtttgacgccgtgctggccagcaccaagacgcacaagctgcaagacggc
accgacttctacaccatcaacgaactgggctacgtgcccgtgctggagctggacaacggc
gagcgcctgcgcgaaggccccgccatcgtgcagtacgtggccgaccaggtgcccagcaag
ggcctggcccctgcccacggcaccatggagcgctaccgcctgcaagagtggctgaccttc
atcggtaccgagctgcacaagggccacagcccactgtttgcccccaacacgcccgaagag
tacaagcccatcgtgcgcgaacgcctgcaaagccgctttgcatgggtcgacaagcaactg
gcaggcaaggactacctgctgggcagcttcagcgtggccgacggctacctgtacaccgtc
tcgcgctggggccagtttgtgggcgtggacacctcgggcctggcaaacctgcaagccttc
aaacagcgcatggaagcacgcccaggcgtgcaagccgccttgaaggcggaaggcctgctc
aagtaa

DBGET integrated database retrieval system