KEGG   Acidovorax carolinensis P4: CBP36_01025Help
Entry
CBP36_01025       CDS       T04962                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00473  D-Alanine metabolism
acip01100  Metabolic pathways
acip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acip00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBP36_01025
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CBP36_01025
Enzymes [BR:acip01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CBP36_01025
Peptidoglycan biosynthesis and degradation proteins [BR:acip01011]
 Precursor biosynthesis
  Racemase
   CBP36_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ART60649
UniProt: A0A240UHY7
LinkDB All DBs
Position
219126..220241
Genome map
AA seq 371 aa AA seqDB search
MPRPIHATIHTAALQHNLERVRQAVPDAKTWAVVKANAYGHGIERAFEGLRAADGFALLD
LAEAERVRHLGWRGPILLLEGVFEPRDLELCSRLSLWHAVHCDEQIDMLAAHKTQVPHRV
FLKLNSGMNRLGFTPQRYRSAWARLNALPQVDEISFMTHFSDADGPRGVAHQMAAFNAAT
QDLPGERSVCNSAATLRFASDAQVRGDWVRAGIVLYGSAPDFPAHNADHWQVQPTMTLAT
RIIGTQQLQAGDTVGYGSRFTAEGPLTIGVAACGYADGYPRHCDTGTPVLVNGVRTRLVG
RVSMDMVTVDLSPVIAAGVDAGFGSEVTLWGSARNGAVLPIDEVAQAAGTVGYELMCALA
PRVPVAVDGVA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatccacgccaccatccataccgctgccctgcaacacaacctcgagcgc
gtgcgccaggccgtgcccgacgccaaaacctgggccgtggtcaaggccaacgcgtatggg
cacggtattgaacgggcctttgaaggcctgcgcgccgccgatggctttgcgctgctcgac
ctggccgaggccgagcgcgtacgccatctgggttggcgggggcccatcctgctgctggag
ggcgtgttcgagccgcgcgatctggagctgtgctcgcgcctctcgctgtggcatgccgtg
cactgcgacgagcagatcgacatgctggccgcccacaagacgcaggtgccgcaccgcgtg
ttcctcaagctgaactcgggcatgaatcgcctcggtttcacgccgcagcgctaccgcagc
gcctgggcgcgcctgaacgcgctgccgcaggtggatgaaatctcgttcatgacccatttc
agcgatgccgatgggccgcgcggcgttgcgcaccagatggcggccttcaacgcggccacg
caagacttaccgggtgagcgcagcgtctgcaacagcgccgccacgctgcgctttgccagc
gacgcccaggtgcgtggcgactgggtgcgcgcgggcatcgtgctgtatggcagtgcgccc
gattttccggcccacaacgccgaccattggcaggtgcagcccaccatgacgctggccacc
cgcatcatcggcacgcagcagctgcaggcgggtgacaccgtgggctacggctcgcggttc
acggccgaggggccgctcaccatcggcgtggccgcctgtggttatgccgatggctacccg
cgccattgcgacaccggcacgcccgtgctggtgaacggcgtgcgcacgcgcctggtgggg
cgggtgagcatggacatggtgacggtggacctgagccccgtgattgcggccggcgtggac
gccggtttcggcagcgaggtcacgttgtggggcagcgcccgcaatggcgccgtgctgccc
atcgacgaggtggcgcaggctgctggcaccgtgggctacgagctgatgtgcgcgctggcg
ccgcgcgtgcctgtggcggtggacggcgttgcctga

DBGET integrated database retrieval system