KEGG   Acidovorax carolinensis P4: CBP36_01110Help
Entry
CBP36_01110       CDS       T04962                                 

Definition
(GenBank) peptidase M48
Organism
acip  Acidovorax carolinensis P4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48
Motif
Other DBs
NCBI-ProteinID: ART57645
UniProt: A0A240U9A8
LinkDB All DBs
Position
237505..238362
Genome map
AA seq 285 aa AA seqDB search
MCLFCPALPPTAAPSSPWMPRRAFLLAASAGVAAPALAQVDVGSASGMRKLVPAETLESS
ATQQYSQLLAQARAQKALAPPGHPQLQRLHAIARRLIPFTTQWNDRARQWHWEVNLIGSK
QINAFCMPGGKIAFYTGILEQLKLTDDEVAMVMGHEMAHALREHARERIAKSRATGLGLS
LGAQLLGLGDLGNMAANLGTQLLTLKFSRGDESDADLVGLELAARAGYNPEAAVSLWRKM
GNATGSAQGGLAFLSTHPSGPDRIRELESNVPKVQGLYAAARRGG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtgccttttctgcccggcgttgccgcctactgctgccccttcgtcaccctggatgccc
cgccgcgcctttttgctggccgccagcgcaggtgtggccgccccggcgctggcgcaggtg
gatgtgggctcggcctccggcatgcgcaagctggtacccgccgagacgctcgaatcttct
gccacccagcaatacagccagttgctggcccaggcccgcgcccagaaagcgctggcgccg
cccggccacccccaactacagcgcctgcacgccattgcgcggcggctgattcctttcacc
acccagtggaacgaccgggcacgccagtggcactgggaggtcaacttgatcggcagcaag
cagatcaatgccttttgcatgcccggcggcaagattgccttctacaccggcatcctggag
cagctcaagctgaccgacgatgaagtcgccatggtgatgggccacgagatggcccacgcc
ctgcgcgagcacgcccgcgagcgcattgccaaaagcagggccacgggcctggggctttcg
ctgggggcgcagctgctggggctgggtgatctgggcaacatggccgccaacctgggcacc
cagctgctcacgctcaagttcagccggggcgatgagtccgacgccgatctggtggggctg
gaactggccgcacgcgcgggctacaaccccgaagcggccgtgagcctgtggcgcaagatg
ggcaatgccaccggcagcgcgcaaggggggctggcgtttctgtccacgcaccccagcggc
cccgaccggatccgcgaactcgaaagcaacgtgcccaaggtgcaggggctgtatgccgcc
gcacgccgcggtggttga

DBGET integrated database retrieval system