KEGG   Acidovorax carolinensis P4: CBP36_01215
Entry
CBP36_01215       CDS       T04962                                 

Definition
(GenBank) 2-oxo-3-hexenedioate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00362  Benzoate degradation
acip00621  Dioxin degradation
acip00622  Xylene degradation
acip01100  Metabolic pathways
acip01120  Microbial metabolism in diverse environments
acip01220  Degradation of aromatic compounds
Module
acip_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP36_01215
   00622 Xylene degradation
    CBP36_01215
   00621 Dioxin degradation
    CBP36_01215
Enzymes [BR:acip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     CBP36_01215
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: ART60657
UniProt: A0A240UGN1
LinkDB
Position
256823..257611
AA seq 262 aa
MALNASTLDQLAEHLENCQLKAQDTLKITESHPDMDWDDAYAIQDRILARKLARGARVVG
YKAGLTSHAKMKQMGVTDPVFGFLVDEFVVAEGAEIKVSDLIHPKVEPEICFITHTELKG
PGCHIGAVLAASDVVLPGIEVIDSRYRDFKFDLKSVVADNTSAARFVVGGRIAAARDVDL
RTLGVVLEKNGLPVAMGAGAAVLGHPAAAVAMLVNHLGRRGQSLPAGSLVLSGGITEAVA
VQAGDNVTLRIQNLGSVSVRFV
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcactgaacgcaagcaccctcgaccagctcgccgagcatctggaaaactgccagctc
aaggcgcaggacacgctgaagatcacggagtcccaccccgacatggactgggacgacgcc
tacgccatccaggaccgcatcctggcacgcaagctggcccgcggcgcccgcgtcgtcggc
tacaaggcgggcctgacctcgcacgccaagatgaagcagatgggcgtgaccgatccggtg
ttcggctttctggtggacgagttcgtcgtggccgaaggcgcagagatcaaggtcagcgac
ctgatccaccccaaggtcgagcccgagatttgcttcatcacccacaccgaactcaagggc
cccggctgccacatcggcgccgtgctcgccgccagcgacgtggtgctgcccggcatcgag
gtgatcgacagccgctaccgcgacttcaagttcgacctcaagagcgtggtggccgacaac
acctcggccgcgcgcttcgtcgtcggcggacgcattgccgcggcgcgcgatgtggacctg
cgcaccctgggcgtggtgctcgagaaaaacggcttgcccgtggccatgggtgccggcgct
gccgtgctggggcacccggccgccgccgtggccatgctggtcaaccacctggggcggcgc
ggccagtcactgccggcgggttcgctggtgctgtcgggcggcatcacagaggccgtggcg
gtgcaggcgggtgacaacgtcacgctgcgcatccagaacctgggcagcgtgtcggttcgt
tttgtgtaa

DBGET integrated database retrieval system