KEGG   Acidovorax carolinensis P4: CBP36_01255Help
Entry
CBP36_01255       CDS       T04962                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00970  Aminoacyl-tRNA biosynthesis
acip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acip00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBP36_01255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acip03029]
    CBP36_01255
Enzymes [BR:acip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CBP36_01255
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CBP36_01255
Mitochondrial biogenesis [BR:acip03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CBP36_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ART57668
UniProt: A0A240U844
LinkDB All DBs
Position
complement(264605..266107)
Genome map
AA seq 500 aa AA seqDB search
MSIATTRALHDLGVADLAAGLRAKQFSAVEAARHFLARAKAHQNMGAFVALNEDATLAQA
LAADARIAAGTAGALEGVPIAHKDIFVTRDFPSTAGSKMLAGYQSPFDATVVTKLADAGA
VTLGKLNCDEFAMGSANENSAVAPVGFAAPAPVRNPWDTSRIPGGSSGGSAVAVAARLAP
ATTGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASSLDQAGPMARNAEDCALLLS
AMCGPDPDRDSTSLDVPAENFSAKLNDSIDGLRIGIPAEFFGEGLAPDVRAAVDAALKEY
EKLGAKLVPISLPRTELSIPVYYIIAPAEASSNLSRFDGVKFGHRAKNYTDLVDMYKKTR
AEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKIRRMIADDFQNAFKECDLIAGPVAPTV
AWKLGEHGNDPLADYLADIFTLPASLAGLPGMSVPAGFGAGGMPVGLQLIGNYFAEARLL
NAAHRLQQATDFHLRQPGGL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagctaccacccgagccctgcacgacctgggcgttgccgacctggccgccggc
ctgcgcgccaagcaattttctgccgttgaagccgcccgccatttcctggcccgcgcgaag
gcgcaccaaaatatgggcgcatttgtggcactgaacgaagacgccaccctggcgcaagcc
ttggccgccgatgcccgcattgccgctggcacggcgggcgcgctggaaggcgtgccgatt
gcccacaaggacatcttcgtcacgcgcgacttccccagcactgcgggctccaaaatgctg
gcgggctaccagtcgccatttgacgccaccgtggtcaccaagctcgctgacgcgggcgct
gtgacccttggcaaactcaattgcgacgagttcgcgatgggctcggccaacgagaactcg
gccgtggcacccgtgggcttcgccgcccccgcccctgtgcgcaacccctgggacaccagc
cgcattcccggtggctcttcgggcggcagcgctgtggccgtggcagcgcgcctggcgcca
gccacgaccggcaccgacaccggtggctccatccgccaacccgcctcattctgcggtatc
accggtatcaagcccacctatggccgcgccagccgctacggcatgatcgcgttcgcctcc
agcctcgaccaggctggccccatggcccgcaacgctgaggattgcgcgctgctactgtcc
gcgatgtgtggtcccgacccggatcgcgactccacctcgctcgacgtgcctgccgaaaac
ttcagcgccaagctgaacgacagcatcgacggcctgcgcatcggcatccccgccgaattt
tttggcgaaggtctggcccccgacgtgcgcgctgccgtggatgcggcgctcaaggaatac
gaaaagctcggcgccaagctcgtgcccatctcgttgccccggacggagctctcgatcccc
gtctactacatcattgccccagccgaggcgtcgtccaacctttcgcgcttcgacggcgtg
aagttcggccaccgcgccaagaactacaccgacctggtggacatgtacaagaagacccgc
gccgaaggctttggcgacgaggtcaagcgccgcatcatgattggcacctatgtgctgagc
catggctactacgacgcctactacctgcaggcgcaaaaaatccgccgcatgatcgccgac
gacttccagaacgccttcaaggaatgcgacctgatcgccggccccgtggcccccacggtg
gcctggaagctgggcgaacacggcaacgacccgctggccgactatctggccgacatcttc
acgctgcccgcatcgctggccggcttgcccggcatgagcgtgcccgccggatttggcgcg
ggcggcatgcccgtggggctgcagctgatcggcaactacttcgctgaagcccgccttctg
aacgctgcgcaccgcctgcagcaagccaccgatttccacctccgccaacccggaggtctg
tga

DBGET integrated database retrieval system