KEGG   Acidovorax carolinensis P4: CBP36_10980
Entry
CBP36_10980       CDS       T04962                                 

Definition
(GenBank) phosphoribosylformylglycinamidine synthase
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00230  Purine metabolism
acip01100  Metabolic pathways
acip01110  Biosynthesis of secondary metabolites
Module
acip_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CBP36_10980
Enzymes [BR:acip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     CBP36_10980
SSDB
Motif
Pfam: GATase_5 AIRS_C FGAR-AT_N FGAR-AT_linker
Other DBs
NCBI-ProteinID: ART59292
UniProt: A0A240UE12
LinkDB
Position
complement(2359255..2363262)
AA seq 1335 aa
MTLHMTTLAGGNALSNFRAQQLQPALEAIHPKISGIAARFVHLVATDAAPTAPERERLAA
LLAYGDPYAGPQEGAILIVTPRLGTLSPWASKATDIARNCGLAIRRVERITEYRISLKAG
LLGKAPELTAGQLAQVAALLHDRMTESVLADRAAAAALFTELQPVPMEHVDVLAGGRAAL
EAANTRFGLALADDEIDYLVTAFTGLGRNPTDVELMMFAQANSEHCRHKIFNAQFTIDGV
AQDKSLFGMIRHTHQQAPQHTVVAYSDNASVMEGHQVERFVAKMASGADVSSANSYEKSS
ATHHVLMKVETHNHPTAISPFPGASTGAGGEIRDEGATGRGSKPKAGMTGFTVSKLWGST
LGKPEHIASPLQIMVEGPLGGAAFNNEFGRPNLLGYFREYEQTVAGVDRGYHKPIMIAGG
LGVIDAQLTQKIEFPAGSLLIQLGGPGMRIGMGGSAASSMATGTNAAELDFDSVQRGNPE
IERRAQEVINHCWAQGAANPILAIHDVGAGGLSNAFPELTNDAGRGARFDLRAVQLEESG
MAPKEIWSNESQERYVLAIAPESLPLFKAFCERERCPFAVIGTATEERQLVLHDSAATAD
DQKLPVDMPMNVLLGKPPKMHRDVTTVQRSFAPMDLTGVPLQKAVIDVLAHPTVASKRFL
ITIGDRTVGGLSHRDQMVGPWQVPVADCAVTLADYKGFAGEAMSMGERTPLAAINAPASG
RMAVAEAITNLLAAPIELPRVKLSANWMAACGEPGEDADLYATVKAVGMELCPALGISIP
VGKDSLSMRTQWQDGGDRKKVTSPVSLIVSAFASLADVRGTLTPQLNATEDDTTLVLVDL
GKGQSRMGGSILGQTLEQSGDVAPDLDDPQDLVNLVNAVNALRAKGQILAYHDRSDGGLL
AAVAEMAFAGHVGVALNVDMLVTEGDGISDSRMEVGDAKNWSSQVSARREELTLKALFNE
ELGVVLQVRTAERNEVMQTLREHGLSKCSHFIGKTRPVSSSIDAGKGQLQVWRDAKAVFS
APLADLHQVWDAVSWKICQQRDNPDNADAEHAAAGEPTDPGMQLHLTFDASDNVAAPFLN
LSRPKVAILREQGINSHVEMAYAFTEAGFEAFDVHMTDLQTGRARLEDFQGVVACGGFSY
GDTLGAGIGWARSITFNPVLAAQFQGFFGRTDTFGLGVCNGCQMFAELADIIPGAQDWPR
FTTNQSERFEARLSMVEVLESPSLFLQGMAGSRLPIAVAHGEGYANFKYRGNADKAIASM
RFVDNHGAATEQYPFNPNGSAGGLTAVTTADGRFTAMMPHPERVFRNVQMSWTSGDISAL
SPWMRIWRNARKWVG
NT seq 4008 nt   +upstreamnt  +downstreamnt
gtgaccttgcacatgaccacgctggcgggcggcaacgccctcagcaattttcgcgcccaa
cagctccagcccgccctggaggccattcaccccaaaatcagtggcatcgcggcccgcttt
gtgcacctggtggccaccgatgccgcgcccacggcccccgagcgcgagcgcctggccgcc
ttgctggcttatggcgacccgtatgcaggcccgcaagagggcgccatcctcatcgttacg
ccccgcctgggcacgctgtcgccctgggcgtccaaggccaccgatatcgcgcgcaactgc
ggcctggccattcgccgggtcgagcgcatcaccgaataccgcatcagcctcaaggccggg
ctgctgggcaaggcgcccgagctgaccgccgggcagctggcccaggtggctgccttgctg
cacgaccgcatgaccgaatcggtgctggccgaccgcgcggcggctgctgcgctgttcaca
gagttgcagcccgttcccatggagcatgtggatgtgctggccggtggccgcgctgcgctg
gaagccgccaacacccgttttggcctggccctggccgatgatgaaatcgactacctcgtg
accgccttcaccggcctgggccgcaaccccaccgatgtggagttgatgatgtttgcgcag
gccaacagcgagcactgccgccacaagatattcaacgcccagttcaccatcgacggcgtg
gcgcaagacaagagcctgttcggcatgatccgccacacccaccagcaggcgccgcagcac
accgtggtggcgtattcggacaacgcctcggtcatggaaggccaccaggtcgagcgattt
gtggcaaaaatggcctctggcgctgatgtatcaagcgctaatagctatgaaaagagtagt
gcaacccaccatgtgctgatgaaggtggagacgcacaaccaccccacggcgatctcgccg
tttccgggcgcctccaccggcgcgggcggcgaaatccgtgacgagggcgccaccgggcgc
ggctccaagcccaaggccggcatgacggggttcacggtgtccaagctctggggcagcacg
ctgggcaagcccgagcacatcgccagccccttgcagatcatggtggaaggcccgctgggc
ggtgccgcgttcaacaacgagttcggccggcccaacctgctgggctacttccgcgagtac
gagcagaccgtggcgggcgtggaccggggctaccacaagcccatcatgatcgcaggcggc
ctgggcgttattgacgcccagctcacccagaagatcgaattccccgccggctcgctgctg
atccagctgggcggccccggcatgcgcatcggcatgggcggcagcgcggccagctccatg
gccacgggcaccaatgcagccgagctcgacttcgactcggtgcagcgcggtaatcccgag
atcgagcgccgtgcgcaagaggtcatcaaccactgctgggcgcaaggcgcggccaacccc
atcctcgccatccacgacgtgggtgcgggcggtttgagcaatgcattccccgaactgacc
aacgacgcaggccgtggcgcgcgctttgatctgcgcgccgtgcagctcgaagaatcgggc
atggcgcccaaggaaatctggagcaacgagagccaggaacgctacgtgctggccattgcg
cccgagtcgctgcctttgttcaaagccttctgcgagcgcgagcgctgcccgtttgccgtg
atcggcacggccaccgaagaacgccagctggtgctgcacgacagtgctgccacggccgac
gaccagaagctgcccgtggacatgcccatgaacgtgctgctgggcaagccgcccaagatg
caccgcgatgtgaccaccgtgcagcgcagcttcgcgcccatggacttgaccggcgttccg
ctgcaaaaggccgtgatcgacgtgctggcccaccccacggtggcgtccaagcgctttctc
atcaccattggcgaccgcaccgtgggtggcctgagccatcgcgatcagatggtgggcccc
tggcaggtgcccgtggccgattgcgccgtcacgctggccgattacaagggcttcgccggt
gaggccatgagcatgggcgaacgcacgccgctggcggccatcaacgccccggcatcgggc
cgtatggcggtggccgaggccatcaccaacctgctggccgcacccatcgagctgccgcgc
gtcaagctcagcgccaactggatggccgcgtgtggcgagcccggcgaggatgccgacctg
tacgccaccgtgaaggctgtgggcatggaactgtgcccggcgctgggcatctcgatcccc
gtgggcaaggacagcctgtcgatgcgcacgcaatggcaggatggcggcgataggaaaaag
gtcacttcgccggtcagcctgatcgtgagcgcctttgcatcgctggccgatgtgcgcggc
acgctcaccccccagctcaacgccacggaagacgacaccaccctggtgctggtggacctg
ggcaagggccaaagccgcatgggcggcagcatcctgggccagacgcttgagcaaagcggc
gatgtggcgccagacctggacgacccccaggacctggtcaacctcgttaacgccgtgaac
gcgctgcgcgccaagggccagatcctggcctaccacgaccgcagcgacggtggtctgctg
gccgccgtggccgaaatggcctttgccggccatgtgggcgtggccctgaacgtggacatg
ctcgtcaccgaaggcgacgggatcagcgacagccgcatggaagtgggcgacgccaagaac
tggagcagtcaagtgagcgcgcgccgcgaagaactgacgctcaaggccctgttcaatgaa
gaactgggcgtggtgctgcaggtgcgcacggcagagcgcaacgaggtgatgcagaccctg
cgcgagcatggcctgtcgaagtgcagccatttcatcggcaagacgcgccccgtgtcctcc
agcatcgatgctggcaagggtcagttgcaggtgtggcgcgatgccaaggccgttttcagc
gccccgctggccgacctgcaccaggtgtgggatgccgtgagctggaagatctgccagcag
cgcgacaaccccgacaacgccgacgctgagcacgccgcagcgggcgagcccaccgacccg
ggcatgcagctgcatctcacgttcgatgcgtccgacaatgtggcggcgccgttcctgaac
ctctcgcgccccaaggtcgccatcctgcgcgagcagggcatcaattcgcatgtggagatg
gcctacgccttcaccgaagcgggctttgaggcgtttgacgtgcacatgaccgacctgcag
accggccgcgccaggcttgaagacttccagggcgtggtggcctgtggtggcttcagctac
ggcgacacgctgggcgcgggcattggctgggcgcgcagcattaccttcaacccggtgctg
gccgcgcagttccagggcttctttggccgcaccgacacgtttggcctgggcgtgtgcaat
ggctgccagatgtttgccgagctggctgacatcatccccggcgcgcaagactggccgcgc
ttcaccaccaaccagagcgagcgcttcgaggcccgcctgtcgatggtggaagtgctcgaa
tcgcccagcctgtttctgcaaggcatggccggcagccgcctgccgattgccgtggcgcat
ggcgagggctatgccaacttcaaataccgtggcaacgcagacaaggccattgcgtccatg
cgttttgtggacaaccacggcgcggccaccgagcagtatccgttcaaccccaacggcagc
gccggcggcctgaccgccgtgaccacggccgatggccgcttcacggccatgatgccgcac
cccgagcgcgtgttccgcaacgtgcagatgagctggaccagcggtgacatcagtgcgctg
agcccctggatgcgcatctggcgtaacgcccgaaagtgggtggggtga

DBGET integrated database retrieval system