Acidovorax carolinensis P4: CBP36_13615 Help Entry CBP36_13615       CDS       T04962                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism acip  Acidovorax carolinensis P4 Brite KEGG Orthology (KO) [BR:acip00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acip03036]     CBP36_13615 Chromosome and associated proteins [BR:acip03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CBP36_13615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC HALZ DUF5924 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ART59724 UniProt:  A0A240U3P5 LinkDB All DBs Position 2940865..2941143 Genome browser AA seq 92 aa AA seqDB search MASRLVPVVLLVLLAALHAQLWLGRGSIPRVQEMQRQLAAQTAANDQARQANERLNSEVH DLKEGLDMVEEKARSELGMVKPNEVYVQFTPR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcgtcccgacttgtgcccgttgtcctgctggttttgctggcagccctgcacgcccag ctctggctgggccggggcagcattccccgcgtgcaggagatgcagcgccagctggccgcg caaacggcggccaacgaccaggcccgccaggccaatgaacgcctgaactccgaggtgcac gacctcaaggaggggctggacatggtggaagaaaaggcacgcagcgagctgggcatggtc aagcccaacgaggtttacgtgcagttcacgccgcgctga

DBGET integrated database retrieval system